| UniProt ID | PSMD7_DROME | |
|---|---|---|
| UniProt AC | P26270 | |
| Protein Name | 26S proteasome non-ATPase regulatory subunit 7 | |
| Gene Name | Rpn8 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 338 | |
| Subcellular Localization | ||
| Protein Description | Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.. | |
| Protein Sequence | MPSQEVSVNKVIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQKITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVYLASMVRSIIALHNLINNKLANRDAEEGKSDSKEAKEKNKDSKDKDNKETKDKDGKKAEEKADKGKDEGGKGSRK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 154 | Phosphorylation | VHDDGSPTSKTFEHV ECCCCCCCCCCCCCC | 22668510 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSMD7_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSMD7_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSMD7_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PSDE_DROME | Rpn11 | physical | 22036573 | |
| PSD11_DROME | Rpn6 | physical | 22036573 | |
| PSMD1_DROME | Rpn2 | physical | 22036573 | |
| PSMD6_DROME | Rpn7 | physical | 22036573 | |
| PSA1_DROME | Prosalpha6 | physical | 22036573 | |
| PSB4_DROME | Prosbeta7 | physical | 22036573 | |
| PSB3_DROME | Prosbeta3 | physical | 22036573 | |
| ADRM1_DROME | Rpn13 | physical | 22036573 | |
| PSA4_DROME | Prosalpha3 | physical | 22036573 | |
| PRS8_DROME | Rpt6 | physical | 22036573 | |
| PRS4_DROME | Rpt2 | physical | 22036573 | |
| PSMD3_DROME | Rpn3 | physical | 22036573 | |
| PSA3_DROME | Prosalpha7 | physical | 22036573 | |
| PSA5_DROME | Prosalpha5 | physical | 22036573 | |
| PSA2_DROME | Prosalpha2 | physical | 22036573 | |
| PSA71_DROME | Prosalpha4 | physical | 22036573 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
