UniProt ID | PIN4_HUMAN | |
---|---|---|
UniProt AC | Q9Y237 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 | |
Gene Name | PIN4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 131 | |
Subcellular Localization |
Isoform 1: Nucleus, nucleolus. Cytoplasm, cytoskeleton, spindle. Cytoplasm. Colocalizes in the nucleolus during interphase and on the spindle apparatus during mitosis with NPM1. Isoform 2: Mitochondrion. Mitochondrion matrix. Imported in a time |
|
Protein Description | Isoform 1 is involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA.; Isoform 2 binds to double-stranded DNA.. | |
Protein Sequence | MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Acetylation | --MPPKGKSGSGKAG --CCCCCCCCCCCCC | 58.74 | 7306959 | |
11 | Acetylation | KGKSGSGKAGKGGAA CCCCCCCCCCCCCCC | 56.51 | 7306969 | |
18 (in isoform 3) | Phosphorylation | - | 20.07 | - | |
18 (in isoform 2) | Phosphorylation | - | 20.07 | - | |
19 | Phosphorylation | AGKGGAASGSDSADK CCCCCCCCCCCCCCH | 37.99 | 12860119 | |
23 | Phosphorylation | GAASGSDSADKKAQG CCCCCCCCCCHHHCC | 39.81 | 28985074 | |
24 (in isoform 3) | Phosphorylation | - | 37.32 | - | |
24 (in isoform 2) | Phosphorylation | - | 37.32 | - | |
32 | Acetylation | DKKAQGPKGGGNAVK CHHHCCCCCCCCCHH | 76.61 | 19608861 | |
39 | Ubiquitination | KGGGNAVKVRHILCE CCCCCCHHHEEEEHH | 31.01 | 33845483 | |
44 | Phosphorylation | AVKVRHILCEKHGKI CHHHEEEEHHHHHHH | 2.23 | 12860119 | |
45 | S-nitrosocysteine | VKVRHILCEKHGKIM HHHEEEEHHHHHHHH | 6.91 | - | |
45 | S-nitrosylation | VKVRHILCEKHGKIM HHHEEEEHHHHHHHH | 6.91 | 19483679 | |
47 | 2-Hydroxyisobutyrylation | VRHILCEKHGKIMEA HEEEEHHHHHHHHHH | 57.57 | - | |
47 | Acetylation | VRHILCEKHGKIMEA HEEEEHHHHHHHHHH | 57.57 | 23749302 | |
47 | Ubiquitination | VRHILCEKHGKIMEA HEEEEHHHHHHHHHH | 57.57 | - | |
57 | 2-Hydroxyisobutyrylation | KIMEAMEKLKSGMRF HHHHHHHHHHHCCCH | 48.40 | - | |
57 | Acetylation | KIMEAMEKLKSGMRF HHHHHHHHHHHCCCH | 48.40 | 19608861 | |
72 | Ubiquitination | NEVAAQYSEDKARQG HHHHHHHCHHHHHCC | 27.52 | 32015554 | |
72 | Acetylation | NEVAAQYSEDKARQG HHHHHHHCHHHHHCC | 27.52 | - | |
75 | Ubiquitination | AAQYSEDKARQGGDL HHHHCHHHHHCCCCC | 41.22 | 29967540 | |
75 | Acetylation | AAQYSEDKARQGGDL HHHHCHHHHHCCCCC | 41.22 | 25953088 | |
75 | 2-Hydroxyisobutyrylation | AAQYSEDKARQGGDL HHHHCHHHHHCCCCC | 41.22 | - | |
100 | Ubiquitination | PFQEAAFALPVSGMD CCHHHHHCCCCCCCC | 13.26 | 24816145 | |
100 | Acetylation | PFQEAAFALPVSGMD CCHHHHHCCCCCCCC | 13.26 | - | |
119 | Acetylation | TDPPVKTKFGYHIIM CCCCCCCCCEEEEEE | 30.95 | 25953088 | |
122 | Phosphorylation | PVKTKFGYHIIMVEG CCCCCCEEEEEEEEC | 7.93 | 21082442 | |
147 | Phosphorylation | ----------------------- ----------------------- | 19901323 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
19 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
19 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
19 | S | Phosphorylation | Kinase | CK2 | - | Uniprot |
19 | S | Phosphorylation | Kinase | CK2_GROUP | - | PhosphoELM |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
19 | S | Phosphorylation |
| 19369196 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIN4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RRBP1_HUMAN | RRBP1 | physical | 22939629 | |
SLIRP_HUMAN | SLIRP | physical | 22939629 | |
RS19_HUMAN | RPS19 | physical | 22939629 | |
TIM44_HUMAN | TIMM44 | physical | 22939629 | |
SRPRB_HUMAN | SRPRB | physical | 22939629 | |
RAD21_HUMAN | RAD21 | physical | 22939629 | |
SCO2_HUMAN | SCO2 | physical | 22939629 | |
VDAC3_HUMAN | VDAC3 | physical | 22939629 | |
UBE2S_HUMAN | UBE2S | physical | 22939629 | |
PNMA1_HUMAN | PNMA1 | physical | 25416956 | |
CEP72_HUMAN | CEP72 | physical | 25416956 | |
FATE1_HUMAN | FATE1 | physical | 25416956 | |
FAM9B_HUMAN | FAM9B | physical | 25416956 | |
ZBTB9_HUMAN | ZBTB9 | physical | 25416956 | |
TCPE_HUMAN | CCT5 | physical | 26344197 | |
DYHC1_HUMAN | DYNC1H1 | physical | 26344197 | |
SYMC_HUMAN | MARS | physical | 26344197 | |
CHSTF_HUMAN | CHST15 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-32, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Phosphorylation of the N-terminal domain regulates subcellularlocalization and DNA binding properties of the peptidyl-prolylcis/trans isomerase hPar14."; Reimer T., Weiwad M., Schierhorn A., Ruecknagel P.-K., Rahfeld J.-U.,Bayer P., Fischer G.; J. Mol. Biol. 330:955-966(2003). Cited for: PROTEIN SEQUENCE OF 15-25, IDENTIFICATION BY MASS SPECTROMETRY,PHOSPHORYLATION AT SER-19, MUTAGENESIS OF SER-19, AND SUBCELLULARLOCATION. |