OPA3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OPA3_HUMAN
• UniProt AC: Q9H6K4
• Protein Name: Optic atrophy 3 protein
• Gene Name: OPA3
• Organism: Homo sapiens (Human).
• Sequence Length: 179
• Subcellular Localization: Mitochondrion .
• Protein Description: May play some role in mitochondrial processes..
• Protein Sequence: MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	FPMAKLLYLGIRQVS CHHHHHHHHHHHHHC	17.20	29523821
20	Phosphorylation	YLGIRQVSKPLANRI HHHHHHHCHHHHHHH	21.88	24719451
57	Acetylation	HWVEMRTKMRIMGFR HHHHHHHCCHHCCCC	18.80	10638607
169	Phosphorylation	QLCNPGRSASHAVPA HHCCCCCCHHHCCCC	39.78	28348404
171	Phosphorylation	CNPGRSASHAVPASK CCCCCCHHHCCCCCC	17.15	28348404

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OPA3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OPA3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OPA3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
KDM1A_HUMAN	KDM1A	physical	23455924
ANM6_HUMAN	PRMT6	physical	23455924
SUV91_HUMAN	SUV39H1	physical	23455924
OPA3_HUMAN	OPA3	physical	27499296
IDE_HUMAN	IDE	physical	27499296
STML2_HUMAN	STOML2	physical	27499296
CLPB_HUMAN	CLPB	physical	27499296
YMEL1_HUMAN	YME1L1	physical	27499296
SCO2_HUMAN	SCO2	physical	27499296
ECH1_HUMAN	ECH1	physical	27499296
SCO1_HUMAN	SCO1	physical	27499296
TIM23_HUMAN	TIMM23	physical	27499296
C1QBP_HUMAN	C1QBP	physical	27499296
ATPG_HUMAN	ATP5C1	physical	27499296
LAMC1_HUMAN	LAMC1	physical	27499296
ATPO_HUMAN	ATP5O	physical	27499296
COX5A_HUMAN	COX5A	physical	27499296
STAR7_HUMAN	STARD7	physical	27499296
NRDC_HUMAN	NRD1	physical	27499296
MTCH2_HUMAN	MTCH2	physical	27499296
ATP5J_HUMAN	ATP5J	physical	27499296

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.