UniProt ID | NICN1_HUMAN | |
---|---|---|
UniProt AC | Q9BSH3 | |
Protein Name | Nicolin-1 | |
Gene Name | NICN1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 213 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKSPSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
98 | Phosphorylation | EGAQEYVSLFKHQML HHHHHHHHHHHHHHH | 27.47 | 24719451 | |
112 | Phosphorylation | LCDMARISELRLILR HHHHHHHHHHHHHHC | 25.65 | 20068231 | |
142 | Phosphorylation | IYQQGPKSPSVTFPK HHHCCCCCCCCCCCH | 26.07 | 28555341 | |
149 | Ubiquitination | SPSVTFPKWLSHPVP CCCCCCCHHHCCCCC | 57.48 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NICN1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NICN1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NICN1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CK049_HUMAN | C11orf49 | physical | 28514442 | |
LRC49_HUMAN | LRRC49 | physical | 28514442 | |
TTLL1_HUMAN | TTLL1 | physical | 28514442 | |
TPGS1_HUMAN | TPGS1 | physical | 28514442 | |
TPGS2_HUMAN | TPGS2 | physical | 28514442 | |
K1841_HUMAN | KIAA1841 | physical | 28514442 | |
TBC19_HUMAN | TBC1D19 | physical | 28514442 | |
SMG8_HUMAN | SMG8 | physical | 28514442 | |
UBB_HUMAN | UBB | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...