dbPTM

MYF6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MYF6_HUMAN
UniProt AC	P23409
Protein Name	Myogenic factor 6
Gene Name	MYF6
Organism	Homo sapiens (Human).
Sequence Length	242
Subcellular Localization	Nucleus.
Protein Description	Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein..
Protein Sequence	MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
120	Phosphorylation	FEALKRRTVANPNQR HHHHHHCCCCCCCCC	28.18	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MYF6_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MYF6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MYF6_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HTF4_HUMAN	TCF12	physical	21516116
ITF2_HUMAN	TCF4	physical	28514442
HTF4_HUMAN	TCF12	physical	28514442
TFE2_HUMAN	TCF3	physical	28514442
NEST_HUMAN	NES	physical	28514442
ID4_HUMAN	ID4	physical	28514442
MK14_HUMAN	MAPK14	physical	28514442
IIGP5_HUMAN	IRGC	physical	28514442
TBCD4_HUMAN	TBC1D4	physical	28514442
DISC1_HUMAN	DISC1	physical	28514442
CSR2B_HUMAN	CSRP2BP	physical	28514442
MBIP1_HUMAN	MBIP	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MYF6_HUMAN

Related Literatures of Post-Translational Modification