UniProt ID | MYF6_HUMAN | |
---|---|---|
UniProt AC | P23409 | |
Protein Name | Myogenic factor 6 | |
Gene Name | MYF6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 242 | |
Subcellular Localization | Nucleus. | |
Protein Description | Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.. | |
Protein Sequence | MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
120 | Phosphorylation | FEALKRRTVANPNQR HHHHHHCCCCCCCCC | 28.18 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MYF6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MYF6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MYF6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HTF4_HUMAN | TCF12 | physical | 21516116 | |
ITF2_HUMAN | TCF4 | physical | 28514442 | |
HTF4_HUMAN | TCF12 | physical | 28514442 | |
TFE2_HUMAN | TCF3 | physical | 28514442 | |
NEST_HUMAN | NES | physical | 28514442 | |
ID4_HUMAN | ID4 | physical | 28514442 | |
MK14_HUMAN | MAPK14 | physical | 28514442 | |
IIGP5_HUMAN | IRGC | physical | 28514442 | |
TBCD4_HUMAN | TBC1D4 | physical | 28514442 | |
DISC1_HUMAN | DISC1 | physical | 28514442 | |
CSR2B_HUMAN | CSRP2BP | physical | 28514442 | |
MBIP1_HUMAN | MBIP | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...