UniProt ID | ID4_HUMAN | |
---|---|---|
UniProt AC | P47928 | |
Protein Name | DNA-binding protein inhibitor ID-4 | |
Gene Name | ID4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 161 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation (By similarity).. | |
Protein Sequence | MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MKAVSPVRPSGR ---CCCCCCCCCCCC | 23.65 | 30266825 | |
10 | Phosphorylation | AVSPVRPSGRKAPSG CCCCCCCCCCCCCCC | 40.44 | 23403867 | |
49 | Methylation | AAAAAAARCKAAEAA HHHHHHHHHHHHHHH | 20.10 | - | |
87 | Ubiquitination | PTIPPNKKVSKVEIL CCCCCCCCCCHHHHH | 59.38 | 32015554 | |
153 | Ubiquitination | DPAGAVNKQGDSILC CCCCCCCCCCCCCCC | 49.40 | 32015554 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ID4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ID4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ID4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ID4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...