UniProt ID | MAFA_MOUSE | |
---|---|---|
UniProt AC | Q8CF90 | |
Protein Name | Transcription factor MafA | |
Gene Name | Mafa | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 359 | |
Subcellular Localization | Nucleus . Detected in nuclei of pancreas islet beta cells. | |
Protein Description | Acts as a transcriptional factor. Specifically binds the insulin enhancer element RIPE3b. Cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptional activity and is required for its oncogenic activity (By similarity). Regulates the insulin gene transcription. Involved either as an oncogene or as a tumor suppressor, depending on the cell context.. | |
Protein Sequence | MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCSSVPSSPSFCAPSPGTGGGAGGGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAAAAAYEAFRGQSFAGGGGADDMGAGHHHGAHHTAHHHHSAHHHHHHHHHHGGSGHHGGGAGHGGGGAGHHVRLEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAKGAPDFFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | AMGAELPSSPLAIEY HCCCCCCCCCCEEEE | 58.16 | 20208071 | |
14 | Phosphorylation | MGAELPSSPLAIEYV CCCCCCCCCCEEEEC | 23.22 | 20208071 | |
32 | Sumoylation | DLMKFEVKKEPPEAE HCEEEEECCCCCHHH | 44.19 | - | |
49 | Phosphorylation | CHRLPPGSLSSTPLS HHCCCCCCCCCCCCC | 30.74 | 20208071 | |
53 | Phosphorylation | PPGSLSSTPLSTPCS CCCCCCCCCCCCCCC | 25.52 | 20208071 | |
57 | Phosphorylation | LSSTPLSTPCSSVPS CCCCCCCCCCCCCCC | 35.68 | 20208071 | |
60 | Phosphorylation | TPLSTPCSSVPSSPS CCCCCCCCCCCCCCC | 35.26 | - | |
61 | Phosphorylation | PLSTPCSSVPSSPSF CCCCCCCCCCCCCCC | 44.77 | 20208071 | |
65 | Phosphorylation | PCSSVPSSPSFCAPS CCCCCCCCCCCCCCC | 20.63 | 20208071 | |
96 | Phosphorylation | GGAPGPPSGGPGTVG CCCCCCCCCCCCCCC | 60.56 | 20208071 | |
118 | Phosphorylation | LEDLYWMSGYQHHLN HHHHHHHHCCCCCCC | 21.87 | 20208071 | |
132 | Phosphorylation | NPEALNLTPEDAVEA CHHHHCCCHHHHHHH | 24.45 | 20208071 | |
143 | Phosphorylation | AVEALIGSGHHGAHH HHHHHHCCCCCCCCC | 28.14 | 20208071 | |
161 | Phosphorylation | HPAAAAAYEAFRGQS CHHHHHHHHHHCCCC | 11.76 | 20208071 | |
168 | Phosphorylation | YEAFRGQSFAGGGGA HHHHCCCCCCCCCCC | 21.64 | 20208071 | |
234 | Phosphorylation | VRLEERFSDDQLVSM EEHHHHCCHHHHHHH | 46.64 | 20208071 | |
240 | Phosphorylation | FSDDQLVSMSVRELN CCHHHHHHHHHHHHH | 17.58 | 20208071 | |
242 | Phosphorylation | DDQLVSMSVRELNRQ HHHHHHHHHHHHHHH | 15.54 | 20208071 | |
254 | Phosphorylation | NRQLRGFSKEEVIRL HHHHCCCCHHHHHHH | 41.82 | 20208071 | |
276 | Phosphorylation | KNRGYAQSCRFKRVQ HHCCHHHHHHHHHHH | 10.09 | 20208071 | |
290 | Phosphorylation | QQRHILESEKCQLQS HHHHHHHHHHHHHHH | 38.62 | 20208071 | |
297 | Phosphorylation | SEKCQLQSQVEQLKL HHHHHHHHHHHHHHH | 44.80 | 20208071 | |
316 | Phosphorylation | LAKERDLYKEKYEKL HHHHHHHHHHHHHHH | 22.76 | - | |
320 | Phosphorylation | RDLYKEKYEKLAGRG HHHHHHHHHHHCCCC | 21.27 | 20208071 | |
342 | Phosphorylation | AGFPREPSPAQAGPG CCCCCCCCHHHCCCC | 28.28 | 29895711 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
49 | S | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
53 | T | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
57 | T | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
61 | S | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
65 | S | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MAFA_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MAFA_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PSME3_MOUSE | Psme3 | physical | 21830322 | |
KAT2B_MOUSE | Kat2b | physical | 26180087 | |
PDX1_MOUSE | Pdx1 | physical | 26180087 | |
RBBP5_MOUSE | Rbbp5 | physical | 26180087 | |
ASH2L_MOUSE | Ash2l | physical | 26180087 | |
WDR5_MOUSE | Wdr5 | physical | 26180087 | |
DPY30_MOUSE | Dpy30 | physical | 26180087 | |
KDM6A_MOUSE | Kdm6a | physical | 26180087 | |
PAXI1_MOUSE | Paxip1 | physical | 26180087 | |
PGR1A_MOUSE | Pagr1a | physical | 26180087 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...