dbPTM

PDX1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PDX1_MOUSE
UniProt AC	P52946
Protein Name	Pancreas/duodenum homeobox protein 1
Gene Name	Pdx1
Organism	Mus musculus (Mouse).
Sequence Length	284
Subcellular Localization	Nucleus . Cytoplasm, cytosol .
Protein Description	Activates insulin and somatostatin gene transcription. Key regulator of islet peptide hormone expression but also responsible for the development of the pancreas, most probably by determining maturation and differentiation of common pancreatic precursor cells in the developing gut. As part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. Binds the DNA sequence 5'-CC[CT]TAATGGG-3'..
Protein Sequence	MNSEEQYYAATQLYKDPCAFQRGPVPEFSANPPACLYMGRQPPPPPPPQFTSSLGSLEQGSPPDISPYEVPPLASDDPAGAHLHHHLPAQLGLAHPPPGPFPNGTEPGGLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYTAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTPSGGGGGEEPEQDCAVTSGEELLAVPPLPPPGGAVPPGVPAAVREGLLPSGLSVSPQPSSIAPLRPQEPR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	YYAATQLYKDPCAFQ HHHHHHHHCCCCCHH	11.97	28576409
61	Phosphorylation	LGSLEQGSPPDISPY CCCCCCCCCCCCCCC	32.71	22509401
66	Phosphorylation	QGSPPDISPYEVPPL CCCCCCCCCCCCCCC	28.89	22817900
152	Phosphorylation	EENKRTRTAYTRAQL HHCCCCCHHHHHHHH	24.33	17052199
211	Phosphorylation	KEEDKKRSSGTPSGG HHHHHCCCCCCCCCC	41.84	20637728
214	Phosphorylation	DKKRSSGTPSGGGGG HHCCCCCCCCCCCCC	19.07	20637728
231	Phosphorylation	PEQDCAVTSGEELLA CCCCCEECCCCCEEE	16.70	22817900
232	Phosphorylation	EQDCAVTSGEELLAV CCCCEECCCCCEEEC	37.29	22817900
264	Phosphorylation	VREGLLPSGLSVSPQ HHCCCCCCCCCCCCC	52.95	-
267	Phosphorylation	GLLPSGLSVSPQPSS CCCCCCCCCCCCCCC	24.87	24759943
269	Phosphorylation	LPSGLSVSPQPSSIA CCCCCCCCCCCCCCC	17.91	20637728

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
61	S	Phosphorylation	Kinase	GSK3B	P49841	PSP
66	S	Phosphorylation	Kinase	GSK3B	P49841	PSP
152	T	Phosphorylation	Kinase	PASK	Q96RG2	PSP
152	T	Phosphorylation	Kinase	PASK	Q8CEE6	Uniprot
211	S	Phosphorylation	Kinase	HIPK2	Q9H2X6	PSP
214	T	Phosphorylation	Kinase	HIPK2	Q9H2X6	PSP
231	T	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
232	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
269	S	Phosphorylation	Kinase	HIPK2	Q9H2X6	PSP
269	S	Phosphorylation	Kinase	HIPK2	Q9QZR5	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
269	S	Phosphorylation		20637728
Phosphorylated by HIPK2 on Ser-269 upon glucose accumulation.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PDX1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HDAC1_MOUSE	Hdac1	physical	15496408
HDAC2_MOUSE	Hdac2	physical	15496408
PCIF1_MOUSE	Pcif1	physical	15121856
PCIF1_MOUSE	Pcif1	physical	17126328
MEIS1_MOUSE	Meis1	physical	17056599

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PDX1_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Pancreatic and duodenal homeobox 1 (PDX1) phosphorylation at serine-269 is HIPK2-dependent and affects PDX1 subnuclear localization."; An R., da Silva Xavier G., Semplici F., Vakhshouri S., Hao H.X.,Rutter J., Pagano M.A., Meggio F., Pinna L.A., Rutter G.A.; Biochem. Biophys. Res. Commun. 399:155-161(2010). Cited for: PHOSPHORYLATION AT SER-269 BY HIPK2, AND MUTAGENESIS OF SER-269.	20637728 [Abstract]
"Regulation by Per-Arnt-Sim (PAS) kinase of pancreatic duodenalhomeobox-1 nuclear import in pancreatic beta-cells."; An R., da Silva Xavier G., Hao H.X., Semplici F., Rutter J.,Rutter G.A.; Biochem. Soc. Trans. 34:791-793(2006). Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION AT THR-152, AND MUTAGENESIS OFTHR-152.	17052199 [Abstract]