| UniProt ID | MAD2_ARATH | |
|---|---|---|
| UniProt AC | Q9LU93 | |
| Protein Name | Mitotic spindle checkpoint protein MAD2 {ECO:0000303|PubMed:19710914} | |
| Gene Name | MAD2 {ECO:0000303|PubMed:19710914} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 209 | |
| Subcellular Localization | Nucleus . Nucleus envelope . Chromosome . Chromosome, centromere, kinetochore . Cytoplasm, cytoskeleton, spindle . Cytoplasm . Cytoplasmic in interphase cells. Accumulates onto both kinetochores and the spindle microtubules in cell arrested in metaph | |
| Protein Description | Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and delays the onset of anaphase when this process is not complete. It inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate.. | |
| Protein Sequence | MASKTAAAKDIITLHGSAAIVSEFFCYAANSILYNRAVYPEESFVKVKKYGLPMLLIEDESVKSFMSNLTSQISEWLEAGKLQRVVLVIMSKATGEVLERWNFRIETDNEVVDKGVSREKSDKEIMREIQAIMRQVASSVTYLPCLDETCVFDVLAYTDTDVAVPFTWIESDPKLIANPQMVKLHGFDTKIHKVDTLVSYKNDEWDEEE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 61 | Phosphorylation | MLLIEDESVKSFMSN EEEECCHHHHHHHHH | 47.36 | 24894044 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MAD2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MAD2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MAD2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BUB31_ARATH | BUB3.1 | physical | 19710914 | |
| RPB9A_ARATH | NRPB9A | physical | 20706207 | |
| KAT3_ARATH | KAT3 | physical | 20706207 | |
| CP18B_ARATH | AT2G36130 | physical | 20706207 | |
| CYP22_ARATH | AT2G38730 | physical | 20706207 | |
| NU50B_ARATH | AT3G15970 | physical | 20706207 | |
| AGD9_ARATH | AGD9 | physical | 20706207 | |
| RQL3_ARATH | RecQl3 | physical | 20706207 | |
| IF5A2_ARATH | FBR12 | physical | 20706207 | |
| MOS1_ARATH | MOS1 | physical | 20706207 | |
| MSRB3_ARATH | MSRB3 | physical | 20706207 | |
| MSRB2_ARATH | MSRB2 | physical | 20706207 | |
| AB2E_ARATH | RLI2 | physical | 20706207 | |
| MAD1_ARATH | AT5G49880 | physical | 22457071 | |
| MOS1_ARATH | MOS1 | physical | 25429892 | |
| BUBR1_ARATH | BUBR1 | physical | 25262777 | |
| BRK1_ARATH | BRK1 | physical | 25262777 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
