| UniProt ID | BUB31_ARATH | |
|---|---|---|
| UniProt AC | Q9LJN8 | |
| Protein Name | Mitotic checkpoint protein BUB3.1 | |
| Gene Name | BUB3.1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 340 | |
| Subcellular Localization | Nucleus. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, phragmoplast. Cytoplasm, cytoskeleton, spindle. Accumulates onto both kinetochores and the spindle microtubules in cell arrested in metaphase. Starts to localize at kinetochores i | |
| Protein Description | Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments. Promotes the formation of stable end-on bipolar attachments. Necessary for kinetochore localization of BUB1. The BUB1/BUB3 complex plays a role in the inhibition of anaphase-promoting complex or cyclosome (APC/C) when spindle-assembly checkpoint is activated and inhibits the ubiquitin ligase activity of APC/C by phosphorylating its activator CDC20 (By similarity). Essential for gametophyte development.. | |
| Protein Sequence | MTTVTPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEFLHGGAVLDCCFHDDFSGFSVGADYKVRRIVFNVGKEDILGTHDKAVRCVEYSYAAGQVITGSWDKTVKCWDPRGASGPERTQVGTYLQPERVYSMSLVGHRLVVATAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSYTFEEGEKSQEPEAIFVRSVNEIEVKPKPKVYPNPAA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTTVTPSAG ------CCEECCCCC | 19880383 | ||
| 3 | Phosphorylation | -----MTTVTPSAGR -----CCEECCCCCC | 19880383 | ||
| 5 | Phosphorylation | ---MTTVTPSAGREL ---CCEECCCCCCCC | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BUB31_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BUB31_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BUB31_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SUF4_ARATH | SUF4 | physical | 20706207 | |
| MA653_ARATH | PLE | physical | 20706207 | |
| TCPA_ARATH | TCP-1 | physical | 20706207 | |
| IF2B_ARATH | EIF2 BETA | physical | 20706207 | |
| PP387_ARATH | AT5G15980 | physical | 20706207 | |
| HDT3_ARATH | HD2C | physical | 20706207 | |
| SUF4_ARATH | SUF4 | physical | 25429892 | |
| BUBR1_ARATH | BUBR1 | physical | 25262777 | |
| BRK1_ARATH | BRK1 | physical | 25262777 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
