UniProt ID | BUBR1_ARATH | |
---|---|---|
UniProt AC | O22806 | |
Protein Name | Mitotic spindle checkpoint protein BUBR1 | |
Gene Name | BUBR1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 395 | |
Subcellular Localization | Chromosome . Cytoplasm . Nucleus . Chromosome, centromere, kinetochore . Cytoplasm, cytoskeleton, spindle . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasmic in interphase cells. Accumulates onto both kinetochores and th | |
Protein Description | Essential component of the mitotic checkpoint. Required for normal mitosis progression. The mitotic checkpoint delays anaphase until all chromosomes are properly attached to the mitotic spindle. One of its checkpoint functions may be to inhibit the activity of the anaphase-promoting complex/cyclosome (APC/C) by blocking the binding of CDC20 to APC/C (By similarity).. | |
Protein Sequence | MAAETKVQVSDPEAEFLNSKQETGYEWELFKENVRPLKRGRNVGILNHALKSHSDHQLRKNLIEKRRNLIEAIDEYEGDDPLSPWIECIKWVQEAFPPGGECSGLLVIYEQCVRKFWHSERYKDDLRYLKVWLEYAEHCADAEVIYKFLEVNEIGKTHAVYYIAYALHIEFKNKVKTANEIFNLGISRDAKPVEKLNDAYKKFMVRTMRRSNTADEEPKENNDLPSRSFGTLLSRGDNNARRQALGSSNPQAKKLKPNQSSKTPFAIYADAVSDTTSGNQPESDKSRPEFGSWLMLGGRAERNKENNSLPRKWASFKVPQKPIVRTVAAASASTFEVFVDEEECTEEEEEKKKNDETISSSSNVLPLNGGREIKKETELLRQNPLRHFPPNSFLR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of BUBR1_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BUBR1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BUBR1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BUBR1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BUB31_ARATH | BUB3.1 | physical | 19710914 | |
MAD2_ARATH | MAD2 | physical | 19710914 | |
IF2B_ARATH | EIF2 BETA | physical | 20706207 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...