dbPTM

BUBR1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BUBR1_ARATH
UniProt AC	O22806
Protein Name	Mitotic spindle checkpoint protein BUBR1
Gene Name	BUBR1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	395
Subcellular Localization	Chromosome . Cytoplasm . Nucleus . Chromosome, centromere, kinetochore . Cytoplasm, cytoskeleton, spindle . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasmic in interphase cells. Accumulates onto both kinetochores and th
Protein Description	Essential component of the mitotic checkpoint. Required for normal mitosis progression. The mitotic checkpoint delays anaphase until all chromosomes are properly attached to the mitotic spindle. One of its checkpoint functions may be to inhibit the activity of the anaphase-promoting complex/cyclosome (APC/C) by blocking the binding of CDC20 to APC/C (By similarity)..
Protein Sequence	MAAETKVQVSDPEAEFLNSKQETGYEWELFKENVRPLKRGRNVGILNHALKSHSDHQLRKNLIEKRRNLIEAIDEYEGDDPLSPWIECIKWVQEAFPPGGECSGLLVIYEQCVRKFWHSERYKDDLRYLKVWLEYAEHCADAEVIYKFLEVNEIGKTHAVYYIAYALHIEFKNKVKTANEIFNLGISRDAKPVEKLNDAYKKFMVRTMRRSNTADEEPKENNDLPSRSFGTLLSRGDNNARRQALGSSNPQAKKLKPNQSSKTPFAIYADAVSDTTSGNQPESDKSRPEFGSWLMLGGRAERNKENNSLPRKWASFKVPQKPIVRTVAAASASTFEVFVDEEECTEEEEEKKKNDETISSSSNVLPLNGGREIKKETELLRQNPLRHFPPNSFLR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of BUBR1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BUBR1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BUBR1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BUBR1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BUB31_ARATH	BUB3.1	physical	19710914
MAD2_ARATH	MAD2	physical	19710914
IF2B_ARATH	EIF2 BETA	physical	20706207

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BUBR1_ARATH

Related Literatures of Post-Translational Modification