dbPTM

MSRB2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MSRB2_ARATH
UniProt AC	Q9C5C8
Protein Name	Peptide methionine sulfoxide reductase B2, chloroplastic
Gene Name	MSRB2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	202
Subcellular Localization	Plastid, chloroplast .
Protein Description	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Specifically reduces the MetSO R-enantiomer. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. May play an essential function in association with MSRB1 in maintaining vegetative growth during environmental constraints, through the preservation of photosynthetic antennae. MSRB1 and MSRB2 account for most of the leaf peptide MSR capacity..
Protein Sequence	MAFNIITPGRVYSATSLTFVSTIKAAFVKPPLASPSRRNLLRFSSSPLSFPSLRRGFHGGRIVAMGSSAPESVNKPEEEWRAILSPEQFRILRQKGTEYPGTGEYNKVFDDGIYCCAGCGTPLYKSTTKFDSGCGWPAFFDGLPGAITRTPDPDGRRIEITCAACGGHLGHVFKGEGFPTPTDERHCVNSISLKFTPENPTL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
85	Phosphorylation	EEWRAILSPEQFRIL HHHHHHCCHHHHHHH	21.93	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MSRB2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MSRB2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MSRB2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MSRB2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MSRB2_ARATH

Related Literatures of Post-Translational Modification