HAX1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HAX1_MOUSE
• UniProt AC: O35387
• Protein Name: HCLS1-associated protein X-1
• Gene Name: Hax1
• Organism: Mus musculus (Mouse).
• Sequence Length: 280
• Subcellular Localization: Mitochondrion . Endoplasmic reticulum . Nucleus membrane . Cytoplasmic vesicle . Cytoplasm, cell cortex . Cell membrane ; Peripheral membrane protein ; Cytoplasmic side . Sarcoplasmic reticulum . Cytoplasm, P-body . Cytoplasm . Nucleus . Predominantl
• Protein Description: Recruits the Arp2/3 complex to the cell cortex and regulates reorganization of the cortical actin cytoskeleton via its interaction with KCNC3 and the Arp2/3 complex. Slows down the rate of inactivation of KCNC3 channels. Promotes GNA13-mediated cell migration. Involved in the clathrin-mediated endocytosis pathway. May be involved in internalization of ABC transporters such as ABCB11. May inhibit CASP9 and CASP3. Promotes cell survival. May regulate intracellular calcium pools..
• Protein Sequence: MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDDDDDDEAEEDRGAWGRESYAFDGSQPPEEFGFSFSPRGGMRFHGNFGFDDLVRDFNSIFSEMGAWTLPSHSPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFEGVLESHAKPESPKPAPDWGSQGPFHRLDDTWPVSPHSRAKEDKDLDSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDGTVEERRTVVDSEGRRETTVTHQEAHDSSRSDPDSQRSSALDDPFSILDLLLGRWFRSR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSVFDLFRG ------CCHHHHHCC	31.34	-
67	Phosphorylation	PPEEFGFSFSPRGGM CCHHHCCEECCCCCC	25.79	30352176
69	Phosphorylation	EEFGFSFSPRGGMRF HHHCCEECCCCCCCE	16.70	25159016
132	Ubiquitination	TLRDSMLKYPDSHQP CHHHHHHCCCCCCCC	46.20	-
154	Phosphorylation	ESHAKPESPKPAPDW HHHCCCCCCCCCCCC	46.91	27841257
177	Phosphorylation	LDDTWPVSPHSRAKE CCCCCCCCCCCCHHH	16.90	26643407
180	Phosphorylation	TWPVSPHSRAKEDKD CCCCCCCCCHHHCCC	37.00	28066266
190	Phosphorylation	KEDKDLDSQVSQEGL HHCCCHHHHHHHCCC	39.52	21454597
193	Phosphorylation	KDLDSQVSQEGLGPL CCHHHHHHHCCCHHH	18.19	26370283
206	Ubiquitination	PLLQPQPKSYFKSIS HHCCCCCHHHEEEEE	53.17	-
259	Phosphorylation	SDPDSQRSSALDDPF CCCCHHHHHHHCCHH	16.60	26239621

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HAX1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HAX1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HAX1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ADT3_HUMAN	SLC25A6	physical	26496610
CH60_HUMAN	HSPD1	physical	26496610
ITA1_HUMAN	ITGA1	physical	26496610
SPT6H_HUMAN	SUPT6H	physical	26496610
KIF3B_HUMAN	KIF3B	physical	26496610
LGAT1_HUMAN	LPGAT1	physical	26496610
DJC13_HUMAN	DNAJC13	physical	26496610
TRAM1_HUMAN	TRAM1	physical	26496610
NUP62_HUMAN	NUP62	physical	26496610
RBSK_HUMAN	RBKS	physical	26496610
DERL1_HUMAN	DERL1	physical	26496610
ZN768_HUMAN	ZNF768	physical	26496610
CLPB_HUMAN	CLPB	physical	26496610
T126A_HUMAN	TMEM126A	physical	26496610
TIM23_HUMAN	TIMM23	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.