GRAA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GRAA_HUMAN
• UniProt AC: P12544
• Protein Name: Granzyme A
• Gene Name: GZMA
• Organism: Homo sapiens (Human).
• Sequence Length: 262
• Subcellular Localization: Isoform alpha: Secreted. Cytoplasmic granule.
• Protein Description: Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA..
• Protein Sequence: MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
47	Phosphorylation	RPYMVLLSLDRKTIC CCEEEEEECCCCCCC	24.86	24719451
99	Ubiquitination	KQIMLVKKEFPYPCY CEEEEEEECCCCCCC	58.04	29967540
170	N-linked_Glycosylation	SDTLREVNITIIDRK HHHCCEEEEEEECCC	22.41	19159218
200	Phosphorylation	MNMVCAGSLRGGRDS EEEEECCCCCCCCCC	9.07	27080861
226	Phosphorylation	EGVFRGVTSFGLENK CCEECCCCCCCCCCC	22.59	29396449
227	Phosphorylation	GVFRGVTSFGLENKC CEECCCCCCCCCCCC	18.21	29396449
257	Phosphorylation	HLNWIIMTIKGAV-- HCCEEEEEECCCC--	14.77	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GRAA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GRAA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GRAA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HMGB2_HUMAN	HMGB2	physical	11909973
NDUS3_HUMAN	NDUFS3	physical	18485875
NDUS3_MOUSE	Ndufs3	physical	18485875
LMNA_HUMAN	LMNA	physical	11331782
H11_HUMAN	HIST1H1A	physical	11060286
H2B2E_HUMAN	HIST2H2BE	physical	11060286
SET_HUMAN	SET	physical	19059912
GRAA_HUMAN	GZMA	physical	19059912
ACTG_HUMAN	ACTG1	physical	19059912
HNRPK_HUMAN	HNRNPK	physical	19059912
DCHS_HUMAN	HDC	physical	19059912
GOGA2_HUMAN	GOLGA2	physical	19059912
XRCC6_HUMAN	XRCC6	physical	16440001
APEX1_HUMAN	APEX1	physical	17008916
HMGB2_HUMAN	HMGB2	physical	17008916
HSP74_HUMAN	HSPA4	physical	18485875
HS90A_HUMAN	HSP90AA1	physical	18485875

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

N-linked Glycosylation

"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-170, AND MASSSPECTROMETRY.
PubMed: 19159218