NDUS3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDUS3_MOUSE
• UniProt AC: Q9DCT2
• Protein Name: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
• Gene Name: Ndufs3
• Organism: Mus musculus (Mouse).
• Sequence Length: 263
• Subcellular Localization: Mitochondrion inner membrane. Matrix and cytoplasmic side of the mitochondrial inner membrane..
• Protein Description: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)..
• Protein Sequence: MAAAAARVWCRGLLGAASVGRGAGRPSVLWQHVRRESAAADKRPTVRPRSDVTHKQLSAFGEYVAEILPKYVQQVQVSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFGVFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKPETK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	RGLLGAASVGRGAGR HHHHHHHHCCCCCCC	25.27	29514104
42	Acetylation	RESAAADKRPTVRPR HHHHHHCCCCCCCCC	56.39	23864654
108	Succinylation	DHTNAQFKSLADLTA CCCCHHHHHHHHCEE	32.26	23954790
216	Acetylation	LRYDDEVKRVVAEPV EECCHHHHEEEEEHH	37.11	23201123
252	Acetylation	RQPPESLKLEAGDKK CCCCHHHCCCCCCCC	54.27	23201123
258	Acetylation	LKLEAGDKKPETK-- HCCCCCCCCCCCC--	70.12	23864654
259	Acetylation	KLEAGDKKPETK--- CCCCCCCCCCCC---	53.47	24062335
263	Acetylation	GDKKPETK------- CCCCCCCC-------	57.59	23864654

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDUS3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDUS3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDUS3_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of NDUS3_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.