| UniProt ID | FOJO_DROME | |
|---|---|---|
| UniProt AC | P54360 | |
| Protein Name | Extracellular serine/threonine protein kinase four-jointed {ECO:0000305} | |
| Gene Name | fj {ECO:0000312|FlyBase:FBgn0000658} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 583 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . Golgi apparatus, in the wing pouch. Protein four-jointed, secreted isoform: Secreted . |
|
| Protein Description | Golgi serine/threonine protein kinase required for intermediate growth in the proximal-distal axis. Phosphorylates specific residues within extracellular cadherin domains of Fat (ft) and Dachsous (ds) as they transit through the Golgi. [PubMed: 18635802 Acts in ommatidial polarity determination as a secondary signal downstream of Notch, JAK/STAT and wingless. Also necessary for the initiation, up-regulation or maintenance of Notch ligand, Serrate (Ser) expression in legs, thereby participating in a feedback loop with N signaling. Sufficient for joint formation and growth in the leg] | |
| Protein Sequence | MYDIKRLEAGQQKLQQAQQPLGLDLSGQQQQLTCSVITAPEHRANPNPSSISQSNPSEATHMTLLTLRRRRSLQRRACLLSILAAFVFGMALGVVVPMFGLPRHQDSPPDLPEEQIQMVAVEPLSSYRVEFIKETDELSAEQVFRNAFHLEQDKDAPDSMVVKKLDTNDGSIKEFHVQRTASGRYRKGPERRLSKKMPERVQPQETSRSPTTSPTNPTSEHQAGFIEEDVYWGPTVEQALPKGFAAKDQVSWERFVGEQGRVVRLEQGCGRMQNRMVVFADGTRACARYRQNTDQIQGEIFSYYLGQLLNISNLAPSAATVVDTSTPNWAAALGDITQAQWKERRPVVLTRWLSDLEPAGIPQPFQPLERHLNKHDVWNLTRHMQSERQAQSQPHGLLKRLGAASSPGSAHQSNAIEETGTGTETANGALVQRLIELAQWSDLIVFDYLIANLDRVVNNLYNFQWNADIMAAPAHNLARQSASQLLVFLDNESGLLHGYRLLKKYEAYHSLLLDNLCVFRRPTIDALRRLRAAGAGRRLRDLFERTTSAGVRDVLPSLPDKSVKILVERIDRVLGQVQKCQGS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 310 | N-linked_Glycosylation | YYLGQLLNISNLAPS HHHHHHHCHHHCCCC | 44.21 | - | |
| 379 | N-linked_Glycosylation | LNKHDVWNLTRHMQS HCHHHHHHHHHHHHH | 31.23 | - | |
| 491 | N-linked_Glycosylation | QLLVFLDNESGLLHG HHHHEEECCCCHHHH | 47.70 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FOJO_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FOJO_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FOJO_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DS_DROME | ds | genetic | 14757640 | |
| DS_DROME | ds | genetic | 15240556 | |
| FAT_DROME | ft | genetic | 14757640 | |
| WNT4_DROME | Wnt4 | genetic | 15986451 | |
| ENA_DROME | ena | genetic | 11566858 | |
| SERR_DROME | Ser | genetic | 11566858 | |
| DS_DROME | ds | physical | 20434337 | |
| DS_DROME | ds | physical | 18635802 | |
| FAT_DROME | ft | physical | 20434337 | |
| FAT_DROME | ft | physical | 18635802 | |
| SRRT_DROME | Ars2 | physical | 24114784 | |
| CALM_DROME | Cam | physical | 24114784 | |
| FOJO_DROME | fj | physical | 18635802 | |
| KL61_DROME | Klp61F | physical | 24114784 | |
| MY61F_DROME | Myo61F | physical | 24114784 | |
| ATC1_DROME | Ca-P60A | physical | 24114784 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
