UniProt ID | FOJO_DROME | |
---|---|---|
UniProt AC | P54360 | |
Protein Name | Extracellular serine/threonine protein kinase four-jointed {ECO:0000305} | |
Gene Name | fj {ECO:0000312|FlyBase:FBgn0000658} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 583 | |
Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . Golgi apparatus, in the wing pouch. Protein four-jointed, secreted isoform: Secreted . |
|
Protein Description | Golgi serine/threonine protein kinase required for intermediate growth in the proximal-distal axis. Phosphorylates specific residues within extracellular cadherin domains of Fat (ft) and Dachsous (ds) as they transit through the Golgi. [PubMed: 18635802 Acts in ommatidial polarity determination as a secondary signal downstream of Notch, JAK/STAT and wingless. Also necessary for the initiation, up-regulation or maintenance of Notch ligand, Serrate (Ser) expression in legs, thereby participating in a feedback loop with N signaling. Sufficient for joint formation and growth in the leg] | |
Protein Sequence | MYDIKRLEAGQQKLQQAQQPLGLDLSGQQQQLTCSVITAPEHRANPNPSSISQSNPSEATHMTLLTLRRRRSLQRRACLLSILAAFVFGMALGVVVPMFGLPRHQDSPPDLPEEQIQMVAVEPLSSYRVEFIKETDELSAEQVFRNAFHLEQDKDAPDSMVVKKLDTNDGSIKEFHVQRTASGRYRKGPERRLSKKMPERVQPQETSRSPTTSPTNPTSEHQAGFIEEDVYWGPTVEQALPKGFAAKDQVSWERFVGEQGRVVRLEQGCGRMQNRMVVFADGTRACARYRQNTDQIQGEIFSYYLGQLLNISNLAPSAATVVDTSTPNWAAALGDITQAQWKERRPVVLTRWLSDLEPAGIPQPFQPLERHLNKHDVWNLTRHMQSERQAQSQPHGLLKRLGAASSPGSAHQSNAIEETGTGTETANGALVQRLIELAQWSDLIVFDYLIANLDRVVNNLYNFQWNADIMAAPAHNLARQSASQLLVFLDNESGLLHGYRLLKKYEAYHSLLLDNLCVFRRPTIDALRRLRAAGAGRRLRDLFERTTSAGVRDVLPSLPDKSVKILVERIDRVLGQVQKCQGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
310 | N-linked_Glycosylation | YYLGQLLNISNLAPS HHHHHHHCHHHCCCC | 44.21 | - | |
379 | N-linked_Glycosylation | LNKHDVWNLTRHMQS HCHHHHHHHHHHHHH | 31.23 | - | |
491 | N-linked_Glycosylation | QLLVFLDNESGLLHG HHHHEEECCCCHHHH | 47.70 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FOJO_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FOJO_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FOJO_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DS_DROME | ds | genetic | 14757640 | |
DS_DROME | ds | genetic | 15240556 | |
FAT_DROME | ft | genetic | 14757640 | |
WNT4_DROME | Wnt4 | genetic | 15986451 | |
ENA_DROME | ena | genetic | 11566858 | |
SERR_DROME | Ser | genetic | 11566858 | |
DS_DROME | ds | physical | 20434337 | |
DS_DROME | ds | physical | 18635802 | |
FAT_DROME | ft | physical | 20434337 | |
FAT_DROME | ft | physical | 18635802 | |
SRRT_DROME | Ars2 | physical | 24114784 | |
CALM_DROME | Cam | physical | 24114784 | |
FOJO_DROME | fj | physical | 18635802 | |
KL61_DROME | Klp61F | physical | 24114784 | |
MY61F_DROME | Myo61F | physical | 24114784 | |
ATC1_DROME | Ca-P60A | physical | 24114784 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...