| UniProt ID | WNT4_DROME | |
|---|---|---|
| UniProt AC | P40589 | |
| Protein Name | Protein Wnt-4 | |
| Gene Name | Wnt4 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 539 | |
| Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
| Protein Description | Binds as a ligand to a family of frizzled seven-transmembrane receptors and acts through a cascade of genes on the nucleus. Acts downstream of homeotic complex genes in the visceral mesoderm and is required for embryonic segmentation. Also required for cell movement and FAK regulation during ovarian morphogenesis.. | |
| Protein Sequence | MPSPTGVFVLMILTHLSFGLGQVRNEDQLLMVGQNGDLDSSNPAIHHQQHQQHQQHQQHQQHQSNHNLNNGNMNSTILNTLMGNNAGQVVNSSPGGGGSMINQLGSSTSSVPSVIGGGVGSVGNPWHSAVGLGVPGNGMGLPSSHGLGGNMGSHPHGHALAGLAKLGIIVPGGQGLPGNLGYGGTMLNGGGVGGAAGMGLGIGSNTNNMDMQQGLYNEHFISEHTVMAVFTSQGQVGGPCRYMPATRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAVTKDRQCLHPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 74 | N-linked_Glycosylation | NLNNGNMNSTILNTL CCCCCCCCHHHHHHH | 39.75 | - | |
| 284 | N-linked_Glycosylation | QFRYDRWNCSIETRG HHCCCCCCCCCCCCC | 15.56 | - | |
| 315 | Phosphorylation | ALTAAAMTHSIARAC HHHHHHHHHHHHHHH | 14.03 | 22817900 | |
| 317 | Phosphorylation | TAAAMTHSIARACAE HHHHHHHHHHHHHHC | 14.58 | 22817900 | |
| 403 | O-palmitoleoylation | KCKCHGVSGSCSMKT HCCCCCCCCCCCCHH | 29.58 | - | |
| 419 | N-linked_Glycosylation | WKKMADFNATATLLR HHHHHHCHHHHHHHH | 36.61 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WNT4_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WNT4_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WNT4_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HEP_DROME | hep | genetic | 16369482 | |
| WNT5_DROME | Wnt5 | genetic | 17507403 | |
| FRIZ4_DROME | fz4 | physical | 12205098 | |
| PTK7_DROME | otk | physical | 21772251 | |
| FOJO_DROME | fj | physical | 15986451 | |
| FRIZ2_DROME | fz2 | physical | 12205098 | |
| FRIZ_DROME | fz | physical | 12205098 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
