| UniProt ID | FKB42_ARATH | |
|---|---|---|
| UniProt AC | Q9LDC0 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP42 | |
| Gene Name | FKBP42 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 365 | |
| Subcellular Localization |
Cell membrane Single-pass type IV membrane protein. Vacuole membrane Single-pass type IV membrane protein. Endoplasmic reticulum . |
|
| Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Modulates the uptake of MRP substrates into the vacuole; reduces metolachlor-GS (MOC-GS) and enhances 17-beta-estradiol 17-(beta-D-glucuronide) (E(2)17betaG) uptake. Regulates cell elongation and orientation. Functions as a positive regulator of PGP1-mediated auxin transport. Confers drug modulation of PGP1 efflux activity as interaction with NPA or flavonol quercetin prevents its physical and functional interaction with PGP1. Required for the proper localization of auxin-related ABCB transporters. Plays a role in brassinosteroid (BR) signaling pathway.. | |
| Protein Sequence | MDESLEHQTQTHDQESEIVTEGSAVVHSEPSQEGNVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQKYAPDDKAIRRELRALAEQEKALYQKQKEMYKGIFKGKDEGGAKSKSLFWLIVLWQWFVSLFSRIFRRHRVKAD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of FKB42_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKB42_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKB42_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKB42_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AB1C_ARATH | MRP1 | physical | 15133126 | |
| AB2C_ARATH | MRP2 | physical | 15133126 | |
| AB1B_ARATH | ABCB1 | physical | 14517332 | |
| PMA2_ARATH | HA2 | physical | 14517332 | |
| AB19B_ARATH | ABCB19 | physical | 14517332 | |
| AHK5_ARATH | HK5 | physical | 22549467 | |
| PID_ARATH | PID | physical | 22549467 | |
| P2C25_ARATH | AT2G30020 | physical | 22549467 | |
| UTR2_ARATH | UTR2 | physical | 24833385 | |
| HHP2_ARATH | HHP2 | physical | 24833385 | |
| HHP4_ARATH | HHP4 | physical | 24833385 | |
| UBC34_ARATH | UBC34 | physical | 24833385 | |
| UBC32_ARATH | UBC32 | physical | 24833385 | |
| ACBP6_ARATH | ACBP6 | physical | 24833385 | |
| UTR3_ARATH | UTR3 | physical | 24833385 | |
| AB12I_ARATH | AT3G21580 | physical | 24833385 | |
| MSBP2_ARATH | MAPR3 | physical | 24833385 | |
| CP21D_ARATH | AT3G66654 | physical | 24833385 | |
| BET12_ARATH | ATBET12 | physical | 24833385 | |
| TBL18_ARATH | TBL18 | physical | 24833385 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
