ELF4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELF4_ARATH
• UniProt AC: O04211
• Protein Name: Protein EARLY FLOWERING 4
• Gene Name: ELF4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 111
• Subcellular Localization: Nucleus . Diffuse distribution. Targeted to nuclear bodies after interaction with ELF3 (PubMed:22327739).
• Protein Description: Component of the central CCA1/LHY-TOC1 feedback loop in the circadian clock that promotes clock accuracy and is required for sustained rhythms in the absence of daily light/dark cycles. Part of a corepressor complex consisting of ELF4, ELF3, and LUX involved in the transcriptional regulation of APRR9. Increases ELF3 nuclear distribution and localization in nuclear bodies. Required for responsiveness to continuous red, by regulating phytochrome B (phyB) signaling (including during seedling de-etiolation) and gene expression. Mediates both entrainment to an environmental cycle and circadian rhythm sustainability under constant conditions. Controls flowering time. Necessary for light-induced expression of both CCA1 and LHY..
• Protein Sequence: MKRNGETKRRRNVAEEAEQGEDPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISKVVNMYSDLNTSFSSGFHGGKNGHDGGGAAGTRA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Sulfoxidation	EQGEDPAMWENLDRN HCCCCHHHHHHHHHH	5.85	23289948
45	Phosphorylation	SVLDRNRSLIQQVND HHHHHCHHHHHHHHH	33.11	30291188
56	Phosphorylation	QVNDNHQSRMADNMS HHHHHHHHHHHHHHH	19.24	22438062

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELF4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELF4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELF4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TIC_ARATH	TIC	genetic	17496120
HUA2_ARATH	HUA2	genetic	15659097
ELF3_ARATH	ELF3	physical	21753751
PCL1_ARATH	PCL1	physical	21753751
ELF3_ARATH	ELF3	physical	26545401
PCL1_ARATH	PCL1	physical	26545401
LWD1_ARATH	ATAN11	physical	26545401
TIC_ARATH	TIC	physical	26545401
APRR1_ARATH	TOC1	physical	26545401
PHYB_ARATH	PHYB	physical	26545401
PHYC_ARATH	PHYC	physical	26545401
PHYE_ARATH	PHYE	physical	26545401
PHYD_ARATH	PHYD	physical	26545401
PHYA_ARATH	PHYA	physical	26545401
COP1_ARATH	COP1	physical	26545401
SPA1_ARATH	SPA1	physical	26545401
FB348_ARATH	AT2G16365	physical	26545401
14336_ARATH	GRF6	physical	26545401

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks.";
Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.;
Plant Physiol. 150:889-903(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45, AND MASSSPECTROMETRY.
PubMed: 19376835