| UniProt ID | DCTN5_MOUSE | |
|---|---|---|
| UniProt AC | Q9QZB9 | |
| Protein Name | Dynactin subunit 5 | |
| Gene Name | Dctn5 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 182 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. Chromosome, centromere, kinetochore. | |
| Protein Description | ||
| Protein Sequence | MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIIMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MELGELLY -------CCHHHHHC | 9.65 | - | |
| 10 | Ubiquitination | LGELLYNKSEYIETA HHHHHCCHHHEEEEC | 30.98 | - | |
| 21 | Ubiquitination | IETASGNKVSRQSVL EEECCCCCEECCEEE | 45.15 | - | |
| 31 | Phosphorylation | RQSVLCGSQNIVLNG CCEEECCCCEEEECC | 21.03 | 24719451 | |
| 74 | Ubiquitination | SVIRPPFKKFSKGVA CEECCCCCCCCCCEE | 59.70 | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCTN5_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCTN5_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCTN5_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CAZA1_HUMAN | CAPZA1 | physical | 26496610 | |
| CAZA2_HUMAN | CAPZA2 | physical | 26496610 | |
| CAPZB_HUMAN | CAPZB | physical | 26496610 | |
| DCTN1_HUMAN | DCTN1 | physical | 26496610 | |
| FAK1_HUMAN | PTK2 | physical | 26496610 | |
| TRI25_HUMAN | TRIM25 | physical | 26496610 | |
| ACTY_HUMAN | ACTR1B | physical | 26496610 | |
| ACTZ_HUMAN | ACTR1A | physical | 26496610 | |
| DCTN2_HUMAN | DCTN2 | physical | 26496610 | |
| DCTN6_HUMAN | DCTN6 | physical | 26496610 | |
| DCTN3_HUMAN | DCTN3 | physical | 26496610 | |
| VWA8_HUMAN | VWA8 | physical | 26496610 | |
| DCTN4_HUMAN | DCTN4 | physical | 26496610 | |
| ARP10_HUMAN | ACTR10 | physical | 26496610 | |
| UBFD1_HUMAN | UBFD1 | physical | 26496610 | |
| RN219_HUMAN | RNF219 | physical | 26496610 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
