| UniProt ID | COP10_ARATH | |
|---|---|---|
| UniProt AC | Q9LJD7 | |
| Protein Name | Constitutive photomorphogenesis protein 10 | |
| Gene Name | COP10 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 182 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of light signal transduction machinery. Involved in repression of photomorphogenesis in darkness by participating in the CDD complex, a complex probably required to regulate the activity of ubiquitin conjugating enzymes (E2s). Repression of photomorphogenesis is probably mediated by ubiquitination and subsequent degradation of photomorphogenesis-promoting factors such as HY5, HYH and LAF1. Although strongly related to ubiquitin-conjugating enzyme, it has no catalytic activity by itself due to the absence of the conserved Cys active site at position 120. It can however enhance the activity of E2 conjugating enzymes.. | |
| Protein Sequence | MMTPGGSGRLRPLPTAMYAGYSGTASSWVAKTSVSASGKRIQREMAELNIDPPPDCSAGPKGDNLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIFLKPEPYSPALPVIARLYLTDREKHDEVAKEWTLRFAK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of COP10_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COP10_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COP10_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COP10_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CUL4_ARATH | CUL4 | physical | 16844902 | |
| DDB1A_ARATH | DDB1A | physical | 16844902 | |
| DET1_ARATH | DET1 | physical | 16844902 | |
| COP1_ARATH | COP1 | physical | 16844902 | |
| UBC9_ARATH | UBC9 | physical | 19061479 | |
| UBC1_ARATH | UBC1 | physical | 19061479 | |
| UBC4_ARATH | UBC4 | physical | 19061479 | |
| CSN3_ARATH | COP13 | physical | 15342494 | |
| COP1_ARATH | COP1 | physical | 15342494 | |
| PSD11_ARATH | ATS9 | physical | 15342494 | |
| DDB1A_ARATH | DDB1A | physical | 15342494 | |
| CSN5A_ARATH | CSN5A | physical | 15342494 | |
| CSN6A_ARATH | CSN6A | physical | 15342494 | |
| PS6AA_ARATH | RPT5A | physical | 15342494 | |
| UBC9_ARATH | UBC9 | physical | 15342494 | |
| COP1_ARATH | COP1 | physical | 11877375 | |
| CSN3_ARATH | COP13 | physical | 11877375 | |
| CSN4_ARATH | COP8 | physical | 11877375 | |
| CSN8_ARATH | COP9 | physical | 11877375 | |
| COP1_ARATH | COP1 | physical | 20061554 | |
| DET1_ARATH | DET1 | physical | 20061554 | |
| DDB1A_ARATH | DDB1A | physical | 18552200 | |
| DET1_ARATH | DET1 | physical | 25962685 | |
| DET1_ARATH | DET1 | genetic | 25962685 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
