UniProt ID | UBC4_ARATH | |
---|---|---|
UniProt AC | P42748 | |
Protein Name | Ubiquitin-conjugating enzyme E2 4 | |
Gene Name | UBC4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 187 | |
Subcellular Localization | ||
Protein Description | Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.. | |
Protein Sequence | MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDKSSDEELSEEEYGSDNEDDDDDDVAIAGKPDP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
146 | Phosphorylation | VKEYCEKYAKPGEGS HHHHHHHHCCCCCCC | 9.51 | 23776212 | |
153 | Phosphorylation | YAKPGEGSEDKSSDE HCCCCCCCCCCCCCH | 38.02 | 23776212 | |
157 | Phosphorylation | GEGSEDKSSDEELSE CCCCCCCCCCHHHCH | 56.17 | 23776212 | |
158 | Phosphorylation | EGSEDKSSDEELSEE CCCCCCCCCHHHCHH | 55.57 | 23776212 | |
163 | Phosphorylation | KSSDEELSEEEYGSD CCCCHHHCHHHHCCC | 46.36 | 23776212 | |
167 | Phosphorylation | EELSEEEYGSDNEDD HHHCHHHHCCCCCCC | 25.80 | 23776212 | |
169 | Phosphorylation | LSEEEYGSDNEDDDD HCHHHHCCCCCCCCC | 36.04 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBC4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBC4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBC4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBQ3_ARATH | UBQ3 | physical | 16339806 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...