UBC4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBC4_ARATH
• UniProt AC: P42748
• Protein Name: Ubiquitin-conjugating enzyme E2 4
• Gene Name: UBC4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 187
• Protein Description: Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins..
• Protein Sequence: MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDKSSDEELSEEEYGSDNEDDDDDDVAIAGKPDP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
146	Phosphorylation	VKEYCEKYAKPGEGS HHHHHHHHCCCCCCC	9.51	23776212
153	Phosphorylation	YAKPGEGSEDKSSDE HCCCCCCCCCCCCCH	38.02	23776212
157	Phosphorylation	GEGSEDKSSDEELSE CCCCCCCCCCHHHCH	56.17	23776212
158	Phosphorylation	EGSEDKSSDEELSEE CCCCCCCCCHHHCHH	55.57	23776212
163	Phosphorylation	KSSDEELSEEEYGSD CCCCHHHCHHHHCCC	46.36	23776212
167	Phosphorylation	EELSEEEYGSDNEDD HHHCHHHHCCCCCCC	25.80	23776212
169	Phosphorylation	LSEEEYGSDNEDDDD HCHHHHCCCCCCCCC	36.04	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBC4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UBC4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBC4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBQ3_ARATH	UBQ3	physical	16339806

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.