| UniProt ID | CDC21_ARATH | |
|---|---|---|
| UniProt AC | Q9SZA4 | |
| Protein Name | Cell division cycle 20.1, cofactor of APC complex | |
| Gene Name | CDC20-1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 457 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.. | |
| Protein Sequence | MDAGMNNTSSHYKTQARCPLQEHFLPRKPSKENLDRFIPNRSAMNFDYAHFALTEGRKGKDQTAAVSSPSKEAYRKQLAETMNLNHTRILAFRNKPQAPVELLPSNHSASLHQQPKSVKPRRYIPQTSERTLDAPDIVDDFYLNLLDWGSANVLAIALDHTVYLWDASTGSTSELVTIDEEKGPVTSINWAPDGRHVAVGLNNSEVQLWDSASNRQLRTLKGGHQSRVGSLAWNNHILTTGGMDGLIINNDVRIRSPIVETYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIKFWNTHTGACLNSVDTGSQVCSLLWSKNERELLSSHGFTQNQLTLWKYPSMVKMAELTGHTSRVLYMAQSPDGCTVASAAGDETLRFWNVFGVPETAKKAAPKAVSEPFSHVNRIR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of CDC21_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDC21_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDC21_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDC21_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CD27B_ARATH | HBT | physical | 20706207 | |
| APC2_ARATH | APC2 | physical | 20706207 | |
| PYM_ARATH | UVI4 | physical | 20706207 | |
| GIG1_ARATH | UVI4-LIKE | physical | 20706207 | |
| CDC23_ARATH | APC8 | physical | 20706207 | |
| APC1_ARATH | EMB2771 | physical | 20706207 | |
| APC4_ARATH | AT4G21530 | physical | 20706207 | |
| APC5_ARATH | AT1G06590 | physical | 20706207 | |
| APC7_ARATH | AT2G39090 | physical | 20706207 | |
| CDC16_ARATH | APC6 | physical | 20706207 | |
| IF2B_ARATH | EIF2 BETA | physical | 20706207 | |
| APC10_ARATH | APC10 | physical | 21687678 | |
| FZR2_ARATH | FZR2 | physical | 21687678 | |
| BUB31_ARATH | BUB3.1 | physical | 21687678 | |
| MAD2_ARATH | MAD2 | physical | 21687678 | |
| BUBR1_ARATH | BUBR1 | physical | 21687678 | |
| CCB22_ARATH | CYCB2;2 | physical | 21687678 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
