| UniProt ID | BPM3_ARATH | |
|---|---|---|
| UniProt AC | O22286 | |
| Protein Name | BTB/POZ and MATH domain-containing protein 3 | |
| Gene Name | BPM3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 408 | |
| Subcellular Localization | Nucleus . Cytoplasm . | |
| Protein Description | May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.. | |
| Protein Sequence | MSTVGGIEQLIPDSVSTSFIETVNGSHQFTIQGYSLAKGMSPGKFIQSDIFSVGGYDWAIYFYPDGKNPEDQSSYISLFIALASDSNDIRALFELTLMDQSGKGKHKVHSHFDRALEGGPYTLKYKGSMWGYKRFFKRSALETSDYLKDDCLVINCTVGVVRARLEGPKQYGIVLPLSNMGQGLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEPSIFKAMLSFIYTDVLPNVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEKLDVDNVATTLALAEQHQFLQLKAFCLEFVASPANLGAVMKSEGFKHLKQSCPTLLSELLNTVAAADKSSTSGQSNKKRSASSVLGCDTTNVRQLRRRTRKEVRAVS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of BPM3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BPM3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BPM3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BPM3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RA213_ARATH | AT1G22190 | physical | 19843165 | |
| RAP24_ARATH | RAP2.4 | physical | 19843165 | |
| FRL4B_ARATH | AT4G14900 | physical | 21798944 | |
| FIP37_ARATH | FIP37 | physical | 21798944 | |
| U2A2A_ARATH | ATU2AF65A | physical | 21798944 | |
| HAT2_ARATH | HAT2 | physical | 21798944 | |
| BPM3_ARATH | BPM3 | physical | 21798944 | |
| SCE1_ARATH | SCE1 | physical | 21798944 | |
| MEBL_ARATH | AT4G27870 | physical | 21798944 | |
| PPDEX_ARATH | AT4G17486 | physical | 21798944 | |
| IMPA1_ARATH | IMPA-1 | physical | 21798944 | |
| HAT3_ARATH | HAT3 | physical | 21798944 | |
| ATHB5_ARATH | HB5 | physical | 22172674 | |
| ATHB6_ARATH | HB6 | physical | 22172674 | |
| ATB16_ARATH | HB16 | physical | 22172674 | |
| BPM1_ARATH | BPM1 | physical | 15618422 | |
| BPM3_ARATH | BPM3 | physical | 15618422 | |
| BPM5_ARATH | BPM5 | physical | 15618422 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
