RAP24_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAP24_ARATH
• UniProt AC: Q8H1E4
• Protein Name: Ethylene-responsive transcription factor RAP2-4
• Gene Name: RAP2-4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 334
• Subcellular Localization: Nucleus .
• Protein Description: Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity)..
• Protein Sequence: MAAAMNLYTCSRSFQDSGGELMDALVPFIKSVSDSPSSSSAASASAFLHPSAFSLPPLPGYYPDSTFLTQPFSYGSDLQQTGSLIGLNNLSSSQIHQIQSQIHHPLPPTHHNNNNSFSNLLSPKPLLMKQSGVAGSCFAYGSGVPSKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICKSMAETQKQDKSTKSSKKREKKVSSPDLSEKVKAEENSVSIGGSPPVTEFEESTAGSSPLSDLTFADPEEPPQWNETFSLEKYPSYEIDWDSILA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RAP24_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAP24_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAP24_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAP24_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BPM1_ARATH	BPM1	physical	19843165
BPM4_ARATH	BPM4	physical	19843165
BPM5_ARATH	BPM5	physical	19843165
BPM6_ARATH	BPM6	physical	19843165

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.