dbPTM

BPM6_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BPM6_ARATH
UniProt AC	A1L4W5
Protein Name	BTB/POZ and MATH domain-containing protein 6
Gene Name	BPM6
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	415
Subcellular Localization	Nucleus . Cytoplasm .
Protein Description	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins..
Protein Sequence	MSKLMTRTSGSSSPNTIPDQIESPTSSRSVTQTTNGSHQFVIQGYSLAKGIGVGKHIASDNFSVGGYQWTIFVYPDGKNPEDNSSYVSVFIVLASECTEVRALFELSLVDQSGKGKHKVHSHFNRSLDGGPYTLKYRGSMWGYKRFFRRSLLETSDYLKDDCLKINCTVGVVVSEMHCPRLLSIHVPDSELGSHFGKLLDTLQGSDVTFDVAGEKFQAHKLVLAARSQFFRSMFYNTLAENNSDVVISDLEPKVFKALLHFMYKDSLPGDVEPLTAHSFDLLRPSEIDDTLIVKLLAAAEMYNLSRLRLLCESHICKGISISSVSKILALSDKYNASELKSVSLKFTAENLAAVLQTKAYEDLKDDCPNLQSELLKAVAGYDDTSSSGGGKSQSVWAQLSNGGETSSRRVRQRTT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of BPM6_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BPM6_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BPM6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BPM6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ATHB6_ARATH	HB6	physical	22172674

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BPM6_ARATH

Related Literatures of Post-Translational Modification