BPM5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BPM5_ARATH
• UniProt AC: Q1EBV6
• Protein Name: BTB/POZ and MATH domain-containing protein 5
• Gene Name: BPM5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 410
• Subcellular Localization: Nucleus . Cytoplasm .
• Protein Description: May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins..
• Protein Sequence: MSESVIQGSNPDRVLSPTSSKSVTQTVNGSHQFVIQGYSLAKGMGIGKHIASDNFSVGGYQWGIFFYPDGKNPEDNSSYVSVFIALASEGTEVRALFELALVDQSGKGKHKVHSHFERSLDGGPYTLKYRGSMWGYKRFFRRSILETSDYLKDDCLIINCTVGVVVSEILCPQLHSVHVPDSELGSHFGVLLDSMEGSDITFNIAGEKFLAHKLVLAARSPFFKSKFFSEFEANNTEVTINDLEPKVFKALLQFMYKDSLPEDVEPATAHTFERLKLSEIYETLIVKVLAAADKYDLIRLRLLCESHICKGVSVKSVAKILALADRYNAKELKGVCLKFTAENLAAVLETDAYQQMKDECVTLQSELLKAVAGHEEGSNSTGGAKSQSVWAQLSDGGGDTTSRHVRQRTT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSESVIQGS ------CCCCCCCCC	38.28	25561503
9	Phosphorylation	SESVIQGSNPDRVLS CCCCCCCCCCCCCCC	28.90	30407730
16	Phosphorylation	SNPDRVLSPTSSKSV CCCCCCCCCCCCCCC	24.23	19880383
18	Phosphorylation	PDRVLSPTSSKSVTQ CCCCCCCCCCCCCEE	42.11	25561503
19	Phosphorylation	DRVLSPTSSKSVTQT CCCCCCCCCCCCEEE	38.87	25561503
20	Phosphorylation	RVLSPTSSKSVTQTV CCCCCCCCCCCEEEE	31.28	30407730
378	Phosphorylation	VAGHEEGSNSTGGAK HHCCCCCCCCCCCCC	30.77	30407730
380	Phosphorylation	GHEEGSNSTGGAKSQ CCCCCCCCCCCCCCC	30.08	30407730
381	Phosphorylation	HEEGSNSTGGAKSQS CCCCCCCCCCCCCCE	43.83	30407730
394	Phosphorylation	QSVWAQLSDGGGDTT CEEEEEECCCCCCCC	23.33	30291188
400	Phosphorylation	LSDGGGDTTSRHVRQ ECCCCCCCCHHHHHC	29.91	23776212
401	Phosphorylation	SDGGGDTTSRHVRQR CCCCCCCCHHHHHCC	28.62	19880383
402	Phosphorylation	DGGGDTTSRHVRQRT CCCCCCCHHHHHCCC	23.60	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BPM5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BPM5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BPM5_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of BPM5_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.