RA213_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RA213_ARATH
• UniProt AC: Q9LM15
• Protein Name: Ethylene-responsive transcription factor RAP2-13
• Gene Name: RAP2-13
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 261
• Subcellular Localization: Nucleus .
• Protein Description: Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity)..
• Protein Sequence: MTTSMDFYSNKTFQQSDPFGGELMEALLPFIKSPSNDSSAFAFSLPAPISYGSDLHSFSHHLSPKPVSMKQTGTSAAKPTKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPDLRHNDEYQPLQSSVDAKLEAICQNLAETTQKQVRSTKKSSSRKRSSTVAVKLPEEDYSSAGSSPLLTESYGSGGSSSPLSELTFGDTEEEIQPPWNENALEKYPSYEIDWDSILQCSSLVN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RA213_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RA213_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RA213_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RA213_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BPM1_ARATH	BPM1	physical	19843165
CIPKB_ARATH	SIP4	physical	24823379
ABI5_ARATH	ABI5	physical	24823379
HA22D_ARATH	HVA22D	physical	24823379
PUB35_ARATH	AT4G25160	physical	24823379
CIPKE_ARATH	SR1	physical	24823379
NADB_ARATH	AO	physical	24823379
P2C78_ARATH	HAI1	physical	24823379

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.