dbPTM

ATHB5_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ATHB5_ARATH
UniProt AC	P46667
Protein Name	Homeobox-leucine zipper protein ATHB-5
Gene Name	ATHB-5
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	312
Subcellular Localization	Nucleus.
Protein Description	Probable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment. Binds to the DNA sequence 5'-CAATNATTG-3'..
Protein Sequence	MKRSRGSSDSLSGFLPIRHSTTDKQISPRPTTTGFLYSGAGDYSQMFDALEDDGSLEDLGGVGHASSTAAEKKRRLGVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYGVLKSNFDALKRNRDSLQRDNDSLLGQIKELKAKLNVEGVKGIEENGALKAVEANQSVMANNEVLELSHRSPSPPPHIPTDAPTSELAFEMFSIFPRTENFRDDPADSSDSSAVLNEEYSPNTVEAAGAVAATTVEMSTMGCFSQFVKMEEHEDLFSGEEACKLFADNEQWYCSDQWNS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MKRSRGSSDSLSGF -CCCCCCCCCCCCCC	29.84	29654922
8	Phosphorylation	MKRSRGSSDSLSGFL CCCCCCCCCCCCCCC	33.76	30407730
10	Phosphorylation	RSRGSSDSLSGFLPI CCCCCCCCCCCCCCC	26.78	29654922
12	Phosphorylation	RGSSDSLSGFLPIRH CCCCCCCCCCCCCCC	31.30	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ATHB5_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ATHB5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ATHB5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ATHB5_ARATH	HB5	physical	11247607
ATHB6_ARATH	HB6	physical	11247607
ATHB7_ARATH	HB-7	physical	11247607
ATB12_ARATH	HB-12	physical	11247607
ATB16_ARATH	HB16	physical	11247607

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ATHB5_ARATH

Related Literatures of Post-Translational Modification