UniProt ID | ARL4D_HUMAN | |
---|---|---|
UniProt AC | P49703 | |
Protein Name | ADP-ribosylation factor-like protein 4D | |
Gene Name | ARL4D | |
Organism | Homo sapiens (Human). | |
Sequence Length | 201 | |
Subcellular Localization | Nucleus, nucleolus. Cell membrane . Nucleus . Cytoplasm . | |
Protein Description | Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.. | |
Protein Sequence | MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNHLTEMA ------CCCCHHHCC | 30.20 | - | |
42 | Ubiquitination | TSLLYRLKFKEFVQS CHHHHHHHHHHHHHH | 45.45 | 22817900 | |
44 | Ubiquitination | LLYRLKFKEFVQSVP HHHHHHHHHHHHHCC | 48.97 | 21906983 | |
53 | Ubiquitination | FVQSVPTKGFNTEKI HHHHCCCCCCCCCEE | 56.27 | 29967540 | |
59 | Ubiquitination | TKGFNTEKIRVPLGG CCCCCCCEEEEECCC | 33.50 | 29967540 | |
113 | Ubiquitination | AERLEEAKVELHRIS HHHHHHHHHHHHHHH | 39.25 | 29967540 | |
123 | Phosphorylation | LHRISRASDNQGVPV HHHHHCCCCCCCCCE | 35.66 | - | |
136 | Ubiquitination | PVLVLANKQDQPGAL CEEEEECCCCCCCCC | 50.04 | 29967540 | |
144 | Phosphorylation | QDQPGALSAAEVEKR CCCCCCCCHHHHHHH | 25.54 | 25072903 | |
150 | Ubiquitination | LSAAEVEKRLAVREL CCHHHHHHHHHHHHH | 58.86 | 21906983 | |
189 | Ubiquitination | RLYEMILKRKKAARG HHHHHHHHHHHHHCC | 51.77 | 21906983 | |
191 | Ubiquitination | YEMILKRKKAARGGK HHHHHHHHHHHCCCC | 45.22 | 22817900 | |
192 | Ubiquitination | EMILKRKKAARGGKK HHHHHHHHHHCCCCC | 51.84 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL4D_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL4D_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL4D_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DNJA1_HUMAN | DNAJA1 | physical | 16169070 | |
EMAL4_HUMAN | EML4 | physical | 16169070 | |
JIP3_HUMAN | MAPK8IP3 | physical | 16169070 | |
NDRG1_HUMAN | NDRG1 | physical | 16169070 | |
PGAM1_HUMAN | PGAM1 | physical | 16169070 | |
GLU2B_HUMAN | PRKCSH | physical | 16169070 | |
SYEP_HUMAN | EPRS | physical | 16169070 | |
RSMN_HUMAN | SNRPN | physical | 16169070 | |
EI2BA_HUMAN | EIF2B1 | physical | 16169070 | |
TLE1_HUMAN | TLE1 | physical | 16169070 | |
UBR1_HUMAN | UBR1 | physical | 16169070 | |
U119A_HUMAN | UNC119 | physical | 16169070 | |
A4_HUMAN | APP | physical | 21832049 | |
C102B_HUMAN | CCDC102B | physical | 25416956 | |
TERF2_HUMAN | TERF2 | physical | 28514442 | |
TBA3C_HUMAN | TUBA3C | physical | 28514442 | |
TE2IP_HUMAN | TERF2IP | physical | 28514442 | |
GILT_HUMAN | IFI30 | physical | 28514442 | |
CYH2_HUMAN | CYTH2 | physical | 17804820 | |
ARF6_HUMAN | ARF6 | physical | 17804820 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...