| UniProt ID | ARL4D_HUMAN | |
|---|---|---|
| UniProt AC | P49703 | |
| Protein Name | ADP-ribosylation factor-like protein 4D | |
| Gene Name | ARL4D | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 201 | |
| Subcellular Localization | Nucleus, nucleolus. Cell membrane . Nucleus . Cytoplasm . | |
| Protein Description | Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.. | |
| Protein Sequence | MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGNHLTEMA ------CCCCHHHCC | 30.20 | - | |
| 42 | Ubiquitination | TSLLYRLKFKEFVQS CHHHHHHHHHHHHHH | 45.45 | 22817900 | |
| 44 | Ubiquitination | LLYRLKFKEFVQSVP HHHHHHHHHHHHHCC | 48.97 | 21906983 | |
| 53 | Ubiquitination | FVQSVPTKGFNTEKI HHHHCCCCCCCCCEE | 56.27 | 29967540 | |
| 59 | Ubiquitination | TKGFNTEKIRVPLGG CCCCCCCEEEEECCC | 33.50 | 29967540 | |
| 113 | Ubiquitination | AERLEEAKVELHRIS HHHHHHHHHHHHHHH | 39.25 | 29967540 | |
| 123 | Phosphorylation | LHRISRASDNQGVPV HHHHHCCCCCCCCCE | 35.66 | - | |
| 136 | Ubiquitination | PVLVLANKQDQPGAL CEEEEECCCCCCCCC | 50.04 | 29967540 | |
| 144 | Phosphorylation | QDQPGALSAAEVEKR CCCCCCCCHHHHHHH | 25.54 | 25072903 | |
| 150 | Ubiquitination | LSAAEVEKRLAVREL CCHHHHHHHHHHHHH | 58.86 | 21906983 | |
| 189 | Ubiquitination | RLYEMILKRKKAARG HHHHHHHHHHHHHCC | 51.77 | 21906983 | |
| 191 | Ubiquitination | YEMILKRKKAARGGK HHHHHHHHHHHCCCC | 45.22 | 22817900 | |
| 192 | Ubiquitination | EMILKRKKAARGGKK HHHHHHHHHHCCCCC | 51.84 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL4D_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL4D_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL4D_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DNJA1_HUMAN | DNAJA1 | physical | 16169070 | |
| EMAL4_HUMAN | EML4 | physical | 16169070 | |
| JIP3_HUMAN | MAPK8IP3 | physical | 16169070 | |
| NDRG1_HUMAN | NDRG1 | physical | 16169070 | |
| PGAM1_HUMAN | PGAM1 | physical | 16169070 | |
| GLU2B_HUMAN | PRKCSH | physical | 16169070 | |
| SYEP_HUMAN | EPRS | physical | 16169070 | |
| RSMN_HUMAN | SNRPN | physical | 16169070 | |
| EI2BA_HUMAN | EIF2B1 | physical | 16169070 | |
| TLE1_HUMAN | TLE1 | physical | 16169070 | |
| UBR1_HUMAN | UBR1 | physical | 16169070 | |
| U119A_HUMAN | UNC119 | physical | 16169070 | |
| A4_HUMAN | APP | physical | 21832049 | |
| C102B_HUMAN | CCDC102B | physical | 25416956 | |
| TERF2_HUMAN | TERF2 | physical | 28514442 | |
| TBA3C_HUMAN | TUBA3C | physical | 28514442 | |
| TE2IP_HUMAN | TERF2IP | physical | 28514442 | |
| GILT_HUMAN | IFI30 | physical | 28514442 | |
| CYH2_HUMAN | CYTH2 | physical | 17804820 | |
| ARF6_HUMAN | ARF6 | physical | 17804820 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...