AP4S1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AP4S1_HUMAN
• UniProt AC: Q9Y587
• Protein Name: AP-4 complex subunit sigma-1 {ECO:0000305}
• Gene Name: AP4S1 {ECO:0000312|HGNC:HGNC:575}
• Organism: Homo sapiens (Human).
• Sequence Length: 144
• Subcellular Localization: Golgi apparatus, trans-Golgi network membrane ; Peripheral membrane protein .
• Protein Description: Component of the adaptor protein complex 4 (AP-4). Adaptor protein complexes are vesicle coat components involved both in vesicle formation and cargo selection. They control the vesicular transport of proteins in different trafficking pathways. [PubMed: 10066790]
• Protein Sequence: MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYRQYAALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLNGCIVETNRARILAPLLILDKMSES

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	MVNKQGQTRLSKYYE EECCCCCCHHHHHHC	40.16	19664994
18	Ubiquitination	QGQTRLSKYYEHVDI CCCCHHHHHHCCCCC	57.34	29967540
27	Ubiquitination	YEHVDINKRTLLETE HCCCCCCCHHHHCHH	47.28	29967540
33	Phosphorylation	NKRTLLETEVIKSCL CCHHHHCHHHHHHHH	35.21	23532336
37	Ubiquitination	LLETEVIKSCLSRSN HHCHHHHHHHHHCCC	40.05	33845483
43	Phosphorylation	IKSCLSRSNEQCSFI HHHHHHCCCCCCCEE	41.15	27732954
99	Phosphorylation	DEYFSRVSELDIMFN HHHHHHCHHHHHCCC	31.19	19276368
99 (in isoform 2)	Phosphorylation	-	31.19	28387310
112 (in isoform 4)	Phosphorylation	-	3.61	-
112 (in isoform 2)	Phosphorylation	-	3.61	28387310
113 (in isoform 2)	Phosphorylation	-	2.09	28387310
118 (in isoform 2)	Phosphorylation	-	3.36	28387310
121 (in isoform 2)	Phosphorylation	-	9.81	28387310
130 (in isoform 3)	Phosphorylation	-	22.63	-
131 (in isoform 3)	Phosphorylation	-	3.62	-
132 (in isoform 3)	Phosphorylation	-	3.15	-
135 (in isoform 3)	Phosphorylation	-	3.75	-
140	Ubiquitination	APLLILDKMSES--- HHHHHHHHCCCC---	40.66	24816145
154 (in isoform 2)	Phosphorylation	-		-
155 (in isoform 2)	Phosphorylation	-		-
156 (in isoform 2)	Phosphorylation	-		-
159 (in isoform 2)	Phosphorylation	-		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AP4S1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AP4S1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AP4S1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
TEAD3_HUMAN	TEAD3	physical	21988832
GTF2I_HUMAN	GTF2I	physical	21988832
GALT2_HUMAN	GALNT2	physical	26496610
MECP2_HUMAN	MECP2	physical	26496610
RL10_HUMAN	RPL10	physical	26496610
SL9A1_HUMAN	SLC9A1	physical	26496610
HLTF_HUMAN	HLTF	physical	26496610
LAP2A_HUMAN	TMPO	physical	26496610
LAP2B_HUMAN	TMPO	physical	26496610
AP4M1_HUMAN	AP4M1	physical	26496610
APBP2_HUMAN	APPBP2	physical	26496610
AP4B1_HUMAN	AP4B1	physical	26496610
GOLI4_HUMAN	GOLIM4	physical	26496610
CDC73_HUMAN	CDC73	physical	26496610
TIM29_HUMAN	C19orf52	physical	26496610
AP4AT_HUMAN	ENTHD2	physical	26496610

Drug and Disease Associations

• Kegg Disease
• H01097: Cerebral palsy
• OMIM Disease
• 614067: Cerebral palsy, spastic quadriplegic 6 (CPSQ6)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.