UniProt ID | YI018_YEAST | |
---|---|---|
UniProt AC | Q3E7Z3 | |
Protein Name | Uncharacterized protein YIR018C-A | |
Gene Name | YIR018C-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 45 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPSDYTSHYPVILIKKKKKKIAGMYRHSKRYLEIMSTASAQFVGN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MPSDYTSHYP -----CCCCCCCCCC | 41.78 | 28889911 | |
5 | Phosphorylation | ---MPSDYTSHYPVI ---CCCCCCCCCCEE | 17.93 | 28889911 | |
6 | Phosphorylation | --MPSDYTSHYPVIL --CCCCCCCCCCEEE | 17.64 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YI018_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YI018_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YI018_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDC37_YEAST | CDC37 | genetic | 27708008 | |
DIM1_YEAST | DIM1 | genetic | 27708008 | |
PRP6_YEAST | PRP6 | genetic | 27708008 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
RPB1_YEAST | RPO21 | genetic | 27708008 | |
ERF3_YEAST | SUP35 | genetic | 27708008 | |
SNU56_YEAST | SNU56 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
NBP35_YEAST | NBP35 | genetic | 27708008 | |
YIP1_YEAST | YIP1 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
AFG2_YEAST | AFG2 | genetic | 27708008 | |
RSC9_YEAST | RSC9 | genetic | 27708008 | |
VTI1_YEAST | VTI1 | genetic | 27708008 | |
RNA1_YEAST | RNA1 | genetic | 27708008 | |
RPC6_YEAST | RPC34 | genetic | 27708008 | |
SEC12_YEAST | SEC12 | genetic | 27708008 | |
NAB3_YEAST | NAB3 | genetic | 27708008 | |
BUR1_YEAST | SGV1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...