UniProt ID | YBE4_YEAST | |
---|---|---|
UniProt AC | P38194 | |
Protein Name | Uncharacterized protein YBL044W | |
Gene Name | YBL044W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 122 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGEMLERQKKRLPSKAKYLKYTASITETGNHEADSSVIFRPHHSDVTCSNARRAESRTLPQICSCILLDHGRRTRPEVRTGMVSLHGSFKGFPCFGIRRGISHVLPGQKLRGSCDNWKKRQN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YBE4_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBE4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBE4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBE4_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PRP6_YEAST | PRP6 | genetic | 27708008 | |
ORC2_YEAST | ORC2 | genetic | 27708008 | |
DPOD_YEAST | POL3 | genetic | 27708008 | |
RRP1_YEAST | RRP1 | genetic | 27708008 | |
TFB1_YEAST | TFB1 | genetic | 27708008 | |
RMRP_YEAST | SNM1 | genetic | 27708008 | |
SMD1_YEAST | SMD1 | genetic | 27708008 | |
NUP57_YEAST | NUP57 | genetic | 27708008 | |
PRP19_YEAST | PRP19 | genetic | 27708008 | |
UTP13_YEAST | UTP13 | genetic | 27708008 | |
DBP9_YEAST | DBP9 | genetic | 27708008 | |
NOP2_YEAST | NOP2 | genetic | 27708008 | |
NAT10_YEAST | KRE33 | genetic | 27708008 | |
HRP1_YEAST | HRP1 | genetic | 27708008 | |
NAB3_YEAST | NAB3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...