YB56A_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YB56A_YEAST
• UniProt AC: I2HB52
• Protein Name: Uncharacterized protein YBR056W-A
• Gene Name: YBR056W-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 66
• Protein Sequence: MRHQYYQPQPMYYQPQPQPIYIQQGPPPPRNDCCCCCNCGDCCSAIANVLCCLCLIDLCCSCAGGM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YB56A_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YB56A_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YB56A_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YB56A_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SAD1_YEAST	SAD1	genetic	27708008
KIN28_YEAST	KIN28	genetic	27708008
CDC37_YEAST	CDC37	genetic	27708008
SMT3_YEAST	SMT3	genetic	27708008
TSC11_YEAST	TSC11	genetic	27708008
GNA1_YEAST	GNA1	genetic	27708008
MPPA_YEAST	MAS2	genetic	27708008
DPOD2_YEAST	POL31	genetic	27708008
FIP1_YEAST	FIP1	genetic	27708008
RPC6_YEAST	RPC34	genetic	27708008
TIM23_YEAST	TIM23	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.