| UniProt ID | TSPO_ARATH | |
|---|---|---|
| UniProt AC | O82245 | |
| Protein Name | Translocator protein homolog | |
| Gene Name | TSPO | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 196 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. Plastid, chloroplast membrane Multi-pass membrane protein. Localizes in chloroplast upon salt stress. |
|
| Protein Description | Stress-induced membrane protein that can bind heme and may play a role in the transport of tetrapyrrole intermediates during salt stress and contribute to the detoxification of highly reactive porphyrins in the cytoplasm.. | |
| Protein Sequence | MDSQDIRYRGGDDRDAATTAMAETERKSADDNKGKRDQKRAMAKRGLKSLTVAVAAPVLVTLFATYFLGTSDGYGNRAKSSSWIPPLWLLHTTCLASSGLMGLAAWLVWVDGGFHKKPNALYLYLAQFLLCLVWDPVTFRVGSGVAGLAVWLGQSAALFGCYKAFNEISPVAGNLVKPCLAWAAFVAAVNVKLAVA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MDSQDIRYRG -----CCCCCCCCCC | 28.58 | 27288362 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TSPO_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSPO_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSPO_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NIP11_ARATH | NLM1 | physical | 21798944 | |
| NAC89_ARATH | NAC089 | physical | 21798944 | |
| Y4645_ARATH | AT4G26450 | physical | 21798944 | |
| VAP11_ARATH | VAP | physical | 21798944 | |
| ATG8A_ARATH | APG8A | physical | 25538184 | |
| TIP12_ARATH | TIP2 | physical | 25538184 | |
| PIP27_ARATH | PIP3 | physical | 25538184 | |
| TIP23_ARATH | TIP2;3 | physical | 25538184 | |
| TIP22_ARATH | TIP2;2 | physical | 25538184 | |
| TIP21_ARATH | DELTA-TIP | physical | 25538184 | |
| PIP26_ARATH | PIP2E | physical | 25538184 | |
| TIP11_ARATH | GAMMA-TIP | physical | 25538184 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
