TIP23_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TIP23_ARATH
• UniProt AC: Q9FGL2
• Protein Name: Aquaporin TIP2-3
• Gene Name: TIP2-3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 250
• Subcellular Localization: Vacuole membrane ; Multi-pass membrane protein . Tonoplast.
• Protein Description: Transports methylammonium or ammonium in yeast cells, preferentially at high medium pH. May participate in vacuolar compartmentation and detoxification of ammonium..
• Protein Sequence: MVKIEVGSVGDSFSVSSLKAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDPAGLVAIAIAHAFALFVGVSIAANISGGHLNPAVTLGLAIGGNITLITGFFYWIAQCLGSIVACLLLVFVTNGKSVPTHGVSAGLGAVEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDLSQIWIYWVGPLVGGALAGLIYGDVFIGSYEAVETREIRV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MVKIEVGS -------CEEEEECC	6.63	-
3	"N6,N6-dimethyllysine"	-----MVKIEVGSVG -----CEEEEECCCC	31.67	-
3	Methylation	-----MVKIEVGSVG -----CEEEEECCCC	31.67	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TIP23_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TIP23_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TIP23_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.