TIP12_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TIP12_ARATH
• UniProt AC: Q41963
• Protein Name: Aquaporin TIP1-2
• Gene Name: TIP1-2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 253
• Subcellular Localization: Vacuole membrane ; Multi-pass membrane protein . Tonoplast.
• Protein Description: Water channel required to facilitate the transport of water across cell membrane. May be involved in the osmoregulation in plants under high osmotic stress such as under a high salt condition. Transports urea in yeast cells in a pH-independent manner. Transports H(2)O(2) in yeast cells..
• Protein Sequence: MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTTDY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MPTRNIAI -------CCCCCEEE	7.44	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TIP12_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TIP12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TIP12_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of TIP12_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.