UniProt ID | TIP22_ARATH | |
---|---|---|
UniProt AC | Q41975 | |
Protein Name | Probable aquaporin TIP2-2 | |
Gene Name | TIP2-2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 250 | |
Subcellular Localization |
Vacuole membrane Multi-pass membrane protein . Tonoplast. |
|
Protein Description | Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.. | |
Protein Sequence | MVKIEIGSVGDSFSVASLKAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITVITGFFYWIAQCLGSIVACLLLVFVTNGESVPTHGVAAGLGAIEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLVGGALAGLIYGDVFIGSYAPAPTTESYP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MVKIEIGS -------CEEEEECC | 6.63 | - | |
3 | "N6,N6-dimethyllysine" | -----MVKIEIGSVG -----CEEEEECCCC | 33.07 | - | |
3 | Methylation | -----MVKIEIGSVG -----CEEEEECCCC | 33.07 | - | |
248 | Phosphorylation | APAPTTESYP----- CCCCCCCCCC----- | 40.38 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIP22_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIP22_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIP22_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Y4645_ARATH | AT4G26450 | physical | 21798944 | |
NAC89_ARATH | NAC089 | physical | 21798944 | |
NIP11_ARATH | NLM1 | physical | 21798944 | |
GONS1_ARATH | GONST1 | physical | 22737156 | |
UPS1_ARATH | UPS1 | physical | 22737156 | |
TIP13_ARATH | TIP1;3 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...