| UniProt ID | TIP22_ARATH | |
|---|---|---|
| UniProt AC | Q41975 | |
| Protein Name | Probable aquaporin TIP2-2 | |
| Gene Name | TIP2-2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 250 | |
| Subcellular Localization |
Vacuole membrane Multi-pass membrane protein . Tonoplast. |
|
| Protein Description | Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.. | |
| Protein Sequence | MVKIEIGSVGDSFSVASLKAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITVITGFFYWIAQCLGSIVACLLLVFVTNGESVPTHGVAAGLGAIEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLVGGALAGLIYGDVFIGSYAPAPTTESYP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MVKIEIGS -------CEEEEECC | 6.63 | - | |
| 3 | "N6,N6-dimethyllysine" | -----MVKIEIGSVG -----CEEEEECCCC | 33.07 | - | |
| 3 | Methylation | -----MVKIEIGSVG -----CEEEEECCCC | 33.07 | - | |
| 248 | Phosphorylation | APAPTTESYP----- CCCCCCCCCC----- | 40.38 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIP22_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIP22_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIP22_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| Y4645_ARATH | AT4G26450 | physical | 21798944 | |
| NAC89_ARATH | NAC089 | physical | 21798944 | |
| NIP11_ARATH | NLM1 | physical | 21798944 | |
| GONS1_ARATH | GONST1 | physical | 22737156 | |
| UPS1_ARATH | UPS1 | physical | 22737156 | |
| TIP13_ARATH | TIP1;3 | physical | 24833385 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
