| UniProt ID | PIP26_ARATH | |
|---|---|---|
| UniProt AC | Q9ZV07 | |
| Protein Name | Probable aquaporin PIP2-6 | |
| Gene Name | PIP2-6 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 289 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.. | |
| Protein Sequence | MTKDELTEEESLSGKDYLDPPPVKTFEVRELKKWSFYRAVIAEFIATLLFLYVTVLTVIGFKSQTDINAGGGACASVGLLGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLASKVSLVRAVSYMVAQCLGATCGVGLVKVFQSTYYNRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINPARSFGAAVIYNNQKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAGAMKAYGSVRSQLHELHA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MTKDELTE -------CCHHHCCC | 10.69 | - | |
| 2 | Phosphorylation | ------MTKDELTEE ------CCHHHCCCC | 47.40 | 30407730 | |
| 7 | Phosphorylation | -MTKDELTEEESLSG -CCHHHCCCCHHCCC | 39.02 | 30291188 | |
| 11 | Phosphorylation | DELTEEESLSGKDYL HHCCCCHHCCCCCCC | 30.99 | 30291188 | |
| 13 | Phosphorylation | LTEEESLSGKDYLDP CCCCHHCCCCCCCCC | 53.74 | 30291188 | |
| 17 | Phosphorylation | ESLSGKDYLDPPPVK HHCCCCCCCCCCCCC | 19.25 | 25368622 | |
| 277 | Phosphorylation | RAGAMKAYGSVRSQL HHHHHHHHHHHHHHH | 12.38 | 23776212 | |
| 279 | Phosphorylation | GAMKAYGSVRSQLHE HHHHHHHHHHHHHHH | 11.15 | 23776212 | |
| 282 | Phosphorylation | KAYGSVRSQLHELHA HHHHHHHHHHHHHCC | 34.63 | 24924143 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIP26_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIP26_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIP26_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PIP15_ARATH | PIP1;5 | physical | 21798944 | |
| PIP12_ARATH | PIP1B | physical | 21798944 | |
| PIP27_ARATH | PIP3 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-7; SER-11; SER-13 ANDSER-282, AND MASS SPECTROMETRY. | |
| "Temporal analysis of sucrose-induced phosphorylation changes inplasma membrane proteins of Arabidopsis."; Niittylae T., Fuglsang A.T., Palmgren M.G., Frommer W.B.,Schulze W.X.; Mol. Cell. Proteomics 6:1711-1726(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-282, AND MASSSPECTROMETRY. | |
