UniProt ID | TRM7_HUMAN | |
---|---|---|
UniProt AC | Q9UET6 | |
Protein Name | Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase {ECO:0000255|HAMAP-Rule:MF_03162} | |
Gene Name | FTSJ1 {ECO:0000255|HAMAP-Rule:MF_03162} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 329 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Methylates the 2'-O-ribose of nucleotides at positions 32 and 34 of the tRNA anticodon loop of substrate tRNAs.. | |
Protein Sequence | MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | SKDKRDVYYRLAKEN CCCHHHHHHHHHHHH | - | ||
28 | Ubiquitination | WRARSAFKLLQLDKE CCHHHHHHHHHHCHH | - | ||
34 | Ubiquitination | FKLLQLDKEFQLFQG HHHHHHCHHHHHHHC | 21890473 | ||
43 | Phosphorylation | FQLFQGVTRAVDLCA HHHHHCCHHHHHHHC | 27251275 | ||
164 | Phosphorylation | IFRGRDVTLLYSQLQ ECCCCCCEEEHHHHH | 22115753 | ||
167 | Phosphorylation | GRDVTLLYSQLQVFF CCCCEEEHHHHHHHH | 22115753 | ||
168 | Phosphorylation | RDVTLLYSQLQVFFS CCCEEEHHHHHHHHH | 22115753 | ||
175 | Phosphorylation | SQLQVFFSSVLCAKP HHHHHHHHHHHCCCC | 22115753 | ||
176 | Phosphorylation | QLQVFFSSVLCAKPR HHHHHHHHHHCCCCC | 22115753 | ||
210 | Phosphorylation | EGFIPDLSKPLLDHS CCCCCCCCCCCCCCC | 24719451 | ||
217 (in isoform 2) | Phosphorylation | - | 25159151 | ||
217 | Phosphorylation | SKPLLDHSYDPDFNQ CCCCCCCCCCCCHHH | 25159151 | ||
258 | Phosphorylation | PLDLEGGSEYKYTPP CCCCCCCCCCCCCCC | 29978859 | ||
260 | Phosphorylation | DLEGGSEYKYTPPTQ CCCCCCCCCCCCCCC | 18669648 | ||
261 | Sumoylation | LEGGSEYKYTPPTQP CCCCCCCCCCCCCCC | - | ||
261 | Ubiquitination | LEGGSEYKYTPPTQP CCCCCCCCCCCCCCC | - | ||
262 | Phosphorylation | EGGSEYKYTPPTQPP CCCCCCCCCCCCCCC | 25159151 | ||
263 | Phosphorylation | GGSEYKYTPPTQPPI CCCCCCCCCCCCCCC | 28796482 | ||
266 | Phosphorylation | EYKYTPPTQPPISPP CCCCCCCCCCCCCCC | 28796482 | ||
271 | Phosphorylation | PPTQPPISPPYQEAC CCCCCCCCCCHHHHH | 25159151 | ||
274 | Phosphorylation | QPPISPPYQEACTLK CCCCCCCHHHHHCHH | 21712546 | ||
279 | Phosphorylation | PPYQEACTLKRKGQL CCHHHHHCHHHCCCH | 25159151 | ||
281 | Methylation | YQEACTLKRKGQLAK HHHHHCHHHCCCHHH | - | ||
288 | Ubiquitination | KRKGQLAKEIRPQDC HHCCCHHHHCCCCCC | - | ||
298 | Phosphorylation | RPQDCPISRVDTFPQ CCCCCCCCCCCCCCC | 26074081 | ||
302 | Phosphorylation | CPISRVDTFPQPLAA CCCCCCCCCCCCCCC | 20068231 | ||
314 | Phosphorylation | LAAPQCHTLLAPEME CCCCCCCCEECCCCC | 20068231 | ||
326 | Phosphorylation | EMEDNEMSCSP---- CCCCCCCCCCC---- | 25159151 | ||
328 | Phosphorylation | EDNEMSCSP------ CCCCCCCCC------ | 25159151 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRM7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRM7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRM7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
WDR6_HUMAN | WDR6 | physical | 26344197 | |
DYSF_HUMAN | DYSF | physical | 26496610 | |
CDC37_HUMAN | CDC37 | physical | 26496610 | |
WDR6_HUMAN | WDR6 | physical | 26496610 | |
IBTK_HUMAN | IBTK | physical | 26496610 | |
SIR6_HUMAN | SIRT6 | physical | 26496610 | |
GNL3L_HUMAN | GNL3L | physical | 26496610 | |
MRM1_HUMAN | MRM1 | physical | 26496610 | |
ZFP91_HUMAN | ZFP91 | physical | 26496610 | |
AROS_HUMAN | RPS19BP1 | physical | 26496610 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
309549 | Mental retardation, X-linked 44 (MRX44) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...