TGA1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TGA1_ARATH
• UniProt AC: Q39237
• Protein Name: Transcription factor TGA1
• Gene Name: TGA1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 368
• Subcellular Localization: Nucleus.
• Protein Description: Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters..
• Protein Sequence: MNSTSTHFVPPRRVGIYEPVHQFGMWGESFKSNISNGTMNTPNHIIIPNNQKLDNNVSEDTSHGTAGTPHMFDQEASTSRHPDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLIQLEQELDRARQQGFYVGNGIDTNSLGFSETMNPGIAAFEMEYGHWVEEQNRQICELRTVLHGHINDIELRSLVENAMKHYFELFRMKSSAAKADVFFVMSGMWRTSAERFFLWIGGFRPSDLLKVLLPHFDVLTDQQLLDVCNLKQSCQQAEDALTQGMEKLQHTLADCVAAGQLGEGSYIPQVNSAMDRLEALVSFVNQADHLRHETLQQMYRILTTRQAARGLLALGEYFQRLRALSSSWATRHREPT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
58	Phosphorylation	QKLDNNVSEDTSHGT CCCCCCCCCCCCCCC	31.70	30407730
61	Phosphorylation	DNNVSEDTSHGTAGT CCCCCCCCCCCCCCC	20.69	30407730
62	Phosphorylation	NNVSEDTSHGTAGTP CCCCCCCCCCCCCCC	32.04	30407730
65	Phosphorylation	SEDTSHGTAGTPHMF CCCCCCCCCCCCCCC	19.25	30407730
68	Phosphorylation	TSHGTAGTPHMFDQE CCCCCCCCCCCCCCC	13.93	30407730
77	Phosphorylation	HMFDQEASTSRHPDK CCCCCCCCCCCCHHH	26.60	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
189	S	Phosphorylation	Kinase	TLK1	-	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TGA1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TGA1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TGA1_ARATH	TGA1	physical	11442055
ADF3_ARATH	ADF3	physical	21952135
SUMO2_ARATH	SUMO2	physical	21952135
RB45A_ARATH	RBP45A	physical	21952135
HST_ARATH	HCT	physical	21952135
SPX1_ARATH	SPX1	physical	21952135
RS62_ARATH	EMB3010	physical	21952135
RL363_ARATH	AT5G02450	physical	21952135
GLB3_ARATH	GLB3	physical	21952135
RL321_ARATH	AT4G18100	physical	21952135
RS132_ARATH	RPS13A	physical	21952135
PLY12_ARATH	AT3G53190	physical	21952135
AL2B4_ARATH	ALDH2B4	physical	21952135
RIDA_ARATH	AT3G20390	physical	21952135
KAD7_ARATH	AT3G01820	physical	21952135
RS252_ARATH	AT2G21580	physical	21952135
NDB3A_ARATH	AT2G02510	physical	21952135
OTC_ARATH	OTC	physical	21952135
EXPA1_ARATH	EXPA1	physical	21952135
H2AV3_ARATH	HTA9	physical	21952135
EF1D1_ARATH	AT1G30230	physical	21952135
RL191_ARATH	emb2386	physical	21952135

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.