dbPTM

PLY12_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PLY12_ARATH
UniProt AC	Q9SCP2
Protein Name	Probable pectate lyase 12
Gene Name	At3g53190
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	483
Subcellular Localization
Protein Description
Protein Sequence	MMLQRSCIVLFFSLFLLVPQMVFSMLNRTLLLIPHPDPELVAYQVQWKVNASITRRQALDTTDQAGSTPCITGNPIDDCWKCDPNWPNNRQGLADCGIGFGQYALGGKGGQFYFVTDSSDDDAVNPKPGTLRYGVIQEEPLWIVFPSNMMIKLKQELIFNSYKTLDGRGANVHIVGGGCITLQYVSNIIIHNIHIHHCYQSGNTNVRSSPTHYGFRTKSDGDGISIFGSKDIWIDHCSLSRCKDGLIDAVMGSTGITISNNFFSHHNEVMLLGHSDHYEPDSGMQVTIAFNHFGEKLIQRMPRCRRGYIHVVNNDFTQWEMYAIGGSGNPTINSQGNRYTAPTNPFAKEVTKRVETPDGDWKGWNWRSEGDILVNGAFFVASGEGAEMRYEKAYSVEPKSASFITQITFHSGVLGVGGRNNNLGMWTTTGSEGTSGLDSYNDYTDEMSGAGSTNRLSFSVLVFLLSSISYLVVFTSSTQMFML

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
27	N-linked_Glycosylation	QMVFSMLNRTLLLIP HHHHHHHCCEEEEEC	26.67	-
50	N-linked_Glycosylation	YQVQWKVNASITRRQ EEEEEEECCCEECHH	25.01	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PLY12_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PLY12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PLY12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HHP2_ARATH	HHP2	physical	24833385
HHP4_ARATH	HHP4	physical	24833385
IRX10_ARATH	GUT2	physical	24833385
TCMO_ARATH	C4H	physical	24833385
C98A3_ARATH	CYP98A3	physical	24833385
ELO3L_ARATH	HOS3-1	physical	24833385
CP21D_ARATH	AT3G66654	physical	24833385
BETL2_ARATH	AT1G29060	physical	24833385

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PLY12_ARATH

Related Literatures of Post-Translational Modification