UniProt ID | SPX1_ARATH | |
---|---|---|
UniProt AC | Q8LBH4 | |
Protein Name | SPX domain-containing protein 1 {ECO:0000303|PubMed:18315545} | |
Gene Name | SPX1 {ECO:0000303|PubMed:18315545} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 256 | |
Subcellular Localization | Nucleus . | |
Protein Description | Plays a positive role in plant adaptation to phosphate starvation. [PubMed: 18315545 Inhibits PHR1 DNA-binding activity in a Pi-dependent manner] | |
Protein Sequence | MKFGKSLSNQIEQTLPEWQDKFLSYKELKKRLKLIGSKTADRPVKRLRLDEFSVGISKEEINFIQLLEDELEKFNNFFVEKEEEYIIRLKEFRDRIAKAKDSMEKMIKIRKEIVDFHGEMVLLENYSALNYTGLVKILKKYDKRTGDLMRLPFIQKVLQQPFYTTDLLFKLVKESEAMLDQIFPANETESEIIQAELSEHKFMESLHMKSTIAALRVLKEIRSGSSTVSVFSLPPLQLNGLDETWKKIPLLEQEAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SPX1_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPX1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPX1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPX1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SPX1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...