dbPTM

RL363_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RL363_ARATH
UniProt AC	Q9LZ57
Protein Name	60S ribosomal protein L36-3
Gene Name	RPL36C
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	108
Subcellular Localization
Protein Description
Protein Sequence	MVATGLFVGLNKGHVVTKREQPPRPNNRKGKTSKRTIFIRNLIKEVAGQAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGAGASEKKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
90	Phosphorylation	KRKREEMSSVLRKMR HHHHHHHHHHHHHHH	22.15	25561503
91	Phosphorylation	RKREEMSSVLRKMRS HHHHHHHHHHHHHHH	24.70	25561503
96	Sulfoxidation	MSSVLRKMRSGGAGA HHHHHHHHHHCCCCC	3.13	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RL363_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RL363_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RL363_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RL363_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RL363_ARATH

Related Literatures of Post-Translational Modification