dbPTM

SUMO2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SUMO2_ARATH
UniProt AC	Q9FLP6
Protein Name	Small ubiquitin-related modifier 2
Gene Name	SUMO2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	103
Subcellular Localization	Nucleus . Cytoplasm .
Protein Description	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Required for the massive protein sumoylation in the nucleus induced by heat shock and controlled by SIZ1..
Protein Sequence	MSATPEEDKKPDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGGAKNGLKLFCF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Phosphorylation	------MSATPEEDK ------CCCCCHHHC	40.63	27531888
4	Phosphorylation	----MSATPEEDKKP ----CCCCCHHHCCC	24.75	27545962

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SUMO2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SUMO2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SUMO2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SCE1_ARATH	SCE1	physical	24255109
SIZ1_ARATH	SIZ1	physical	24255109
SINL4_ARATH	AT1G66650	physical	24255109
ASHH2_ARATH	EFS	physical	24255109
JMJ16_ARATH	PKDM7D	physical	24255109
CMT2_ARATH	CMT2	physical	24255109
DME_ARATH	DME	physical	24255109
EXO1_ARATH	AT1G29630	physical	24255109
MOM1_ARATH	MOM	physical	24255109

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SUMO2_ARATH

Related Literatures of Post-Translational Modification