SPZ_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPZ_DROME
• UniProt AC: P48607
• Protein Name: Protein spaetzle
• Gene Name: spz
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 326
• Subcellular Localization: Isoform 8.19: Secreted. Secreted in a cell culture system.; Isoform 8.29: Secreted. Secreted in a cell culture system.; Isoform 11.15: Secreted. Secreted in a cell culture system.; Isoform 11.6: Secreted. Secreted in a cell culture sys
• Protein Description: The activated form, spaetzle C-106, acts as a ligand for the Toll receptor. [PubMed: 12872120 Binding to Toll activates the Toll signaling pathway and induces expression of the antifungal peptide drosomycin]
• Protein Sequence: MMTPMWISLFKVLLLLFAFFATYEAKEYERIIKELFTITNDEGVVLFNTSADSAPFMPIPTQHDDPTQKQKQNQNQSPIPETNRHYHQYHSLIQPDQYFKVQRSPNGKLNLVFNDTFVSLQRTDTEVQSEQPIPPRHPSDTFVFPDSPIAKYRPPQSPARPLRNDTKEHNPCAKDESQHLRNFCTNVDDYPDLSGLTHKLKNNFAKFFSNDLQPTDVSSRVGGSDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDFAANFPQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
48	N-linked_Glycosylation	DEGVVLFNTSADSAP CCCEEEEECCCCCCC	29.03	-
114	N-linked_Glycosylation	GKLNLVFNDTFVSLQ CCEEEEECCCEEEEE	39.68	-
164	N-linked_Glycosylation	SPARPLRNDTKEHNP CCCCCCCCCCCCCCC	69.82	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPZ_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPZ_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPZ_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARP5_DROME	Arp5	physical	14605208
CACT_DROME	cact	genetic	7705656
PIPE_DROME	pip	genetic	20605458
NFKB1_DROME	Rel	genetic	12032070
TOLL_DROME	Tl	genetic	19018662
TOLL_DROME	Tl	genetic	23892553
CIC_DROME	cic	genetic	11714680
TOLL_DROME	Tl	physical	12872120
TOLL_DROME	Tl	physical	15795223
SPZ_DROME	spz	physical	18790733
SPZ_DROME	spz	physical	12872120
SPZ_DROME	spz	physical	9533958

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.