UniProt ID | SPZ_DROME | |
---|---|---|
UniProt AC | P48607 | |
Protein Name | Protein spaetzle | |
Gene Name | spz | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 326 | |
Subcellular Localization |
Isoform 8.19: Secreted. Secreted in a cell culture system. Isoform 8.29: Secreted. Secreted in a cell culture system. Isoform 11.15: Secreted. Secreted in a cell culture system. Isoform 11.6: Secreted. Secreted in a cell culture sys |
|
Protein Description | The activated form, spaetzle C-106, acts as a ligand for the Toll receptor. [PubMed: 12872120 Binding to Toll activates the Toll signaling pathway and induces expression of the antifungal peptide drosomycin] | |
Protein Sequence | MMTPMWISLFKVLLLLFAFFATYEAKEYERIIKELFTITNDEGVVLFNTSADSAPFMPIPTQHDDPTQKQKQNQNQSPIPETNRHYHQYHSLIQPDQYFKVQRSPNGKLNLVFNDTFVSLQRTDTEVQSEQPIPPRHPSDTFVFPDSPIAKYRPPQSPARPLRNDTKEHNPCAKDESQHLRNFCTNVDDYPDLSGLTHKLKNNFAKFFSNDLQPTDVSSRVGGSDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDFAANFPQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | N-linked_Glycosylation | DEGVVLFNTSADSAP CCCEEEEECCCCCCC | 29.03 | - | |
114 | N-linked_Glycosylation | GKLNLVFNDTFVSLQ CCEEEEECCCEEEEE | 39.68 | - | |
164 | N-linked_Glycosylation | SPARPLRNDTKEHNP CCCCCCCCCCCCCCC | 69.82 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPZ_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPZ_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPZ_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARP5_DROME | Arp5 | physical | 14605208 | |
CACT_DROME | cact | genetic | 7705656 | |
PIPE_DROME | pip | genetic | 20605458 | |
NFKB1_DROME | Rel | genetic | 12032070 | |
TOLL_DROME | Tl | genetic | 19018662 | |
TOLL_DROME | Tl | genetic | 23892553 | |
CIC_DROME | cic | genetic | 11714680 | |
TOLL_DROME | Tl | physical | 12872120 | |
TOLL_DROME | Tl | physical | 15795223 | |
SPZ_DROME | spz | physical | 18790733 | |
SPZ_DROME | spz | physical | 12872120 | |
SPZ_DROME | spz | physical | 9533958 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...