| UniProt ID | SPART_HUMAN | |
|---|---|---|
| UniProt AC | Q8N0X7 | |
| Protein Name | Spartin {ECO:0000305} | |
| Gene Name | SPART {ECO:0000312|HGNC:HGNC:18514} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 666 | |
| Subcellular Localization | Cytoplasm . Midbody . Transiently associated with endosomes (PubMed:19580544). Colocalized with IST1 to the ends of Flemming bodies during cytokinesis (PubMed:20719964). | |
| Protein Description | May be implicated in endosomal trafficking, or microtubule dynamics, or both. Participates in cytokinesis. [PubMed: 20719964] | |
| Protein Sequence | MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQIPGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSEEVNLSHIVPCEPVPEEKPKELPEWSEKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQIVDNSQRENQEGAANVNVRGEKDEQTKEVKEAKKKDK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEQEPQNG -------CCCCCCCC | 22814378 | ||
| 22 | Acetylation | IIREAYKKAFLFVNK HHHHHHHHHHHHHCC | 26051181 | ||
| 29 | Acetylation | KAFLFVNKGLNTDEL HHHHHHCCCCCHHHH | 26051181 | ||
| 29 | Ubiquitination | KAFLFVNKGLNTDEL HHHHHHCCCCCHHHH | 21906983 | ||
| 39 | Ubiquitination | NTDELGQKEEAKNYY CHHHHCCHHHHHHHH | - | ||
| 45 | Phosphorylation | QKEEAKNYYKQGIGH CHHHHHHHHHHHHHH | - | ||
| 46 | Phosphorylation | KEEAKNYYKQGIGHL HHHHHHHHHHHHHHH | 22817900 | ||
| 47 | Ubiquitination | EEAKNYYKQGIGHLL HHHHHHHHHHHHHHH | 21906983 | ||
| 58 | Phosphorylation | GHLLRGISISSKESE HHHHHCCCCCCCCCC | 26699800 | ||
| 60 | Phosphorylation | LLRGISISSKESEHT HHHCCCCCCCCCCCC | 26699800 | ||
| 62 | Ubiquitination | RGISISSKESEHTGP HCCCCCCCCCCCCCC | 21890473 | ||
| 82 | Ubiquitination | RQMQQKMKETLQNVR HHHHHHHHHHHHHHH | 21906983 | ||
| 97 | Ubiquitination | TRLEILEKGLATSLQ HHHHHHHHHHHHHHH | 21906983 | ||
| 97 (in isoform 1) | Ubiquitination | - | 22053931 | ||
| 101 | Phosphorylation | ILEKGLATSLQNDLQ HHHHHHHHHHHHHHH | 23403867 | ||
| 102 | Phosphorylation | LEKGLATSLQNDLQE HHHHHHHHHHHHHHH | 23403867 | ||
| 112 | Ubiquitination | NDLQEVPKLYPEFPP HHHHHHHHHCCCCCC | - | ||
| 114 | Phosphorylation | LQEVPKLYPEFPPKD HHHHHHHCCCCCCHH | 25159151 | ||
| 287 | Ubiquitination | PDRSPVLKCTAGAYM CCCCCCEECCCCCCC | - | ||
| 334 | Methylation | LRQMSDLRLQANWNR HHHHHHHHHHHCHHH | 115917573 | ||
| 354 | Phosphorylation | EFQIPGRTRPSSDQL CCCCCCCCCCCHHHH | 23403867 | ||
| 357 | Phosphorylation | IPGRTRPSSDQLKEA CCCCCCCCHHHHHHH | 30108239 | ||
| 358 | Phosphorylation | PGRTRPSSDQLKEAS CCCCCCCHHHHHHHC | 23403867 | ||
| 362 | Ubiquitination | RPSSDQLKEASGTDV CCCHHHHHHHCCCCH | 21906983 | ||
| 362 | Methylation | RPSSDQLKEASGTDV CCCHHHHHHHCCCCH | - | ||
| 362 (in isoform 1) | Ubiquitination | - | 22053931 | ||
| 365 | Phosphorylation | SDQLKEASGTDVKQL HHHHHHHCCCCHHHH | 30108239 | ||
| 367 | Phosphorylation | QLKEASGTDVKQLDQ HHHHHCCCCHHHHHC | 30108239 | ||
| 370 (in isoform 1) | Ubiquitination | - | 22053931 | ||
| 370 | Ubiquitination | EASGTDVKQLDQGNK HHCCCCHHHHHCCCC | 21906983 | ||
| 370 | Methylation | EASGTDVKQLDQGNK HHCCCCHHHHHCCCC | - | ||
| 377 | Ubiquitination | KQLDQGNKDVRHKGK HHHHCCCCCCCCCCC | 21906983 | ||
| 382 | Methylation | GNKDVRHKGKRGKRA CCCCCCCCCCCCCCC | - | ||
| 390 | Ubiquitination | GKRGKRAKDTSSEEV CCCCCCCCCCCCCCC | - | ||
| 392 | Phosphorylation | RGKRAKDTSSEEVNL CCCCCCCCCCCCCCH | 23403867 | ||
| 393 | Phosphorylation | GKRAKDTSSEEVNLS CCCCCCCCCCCCCHH | 23401153 | ||
| 394 | Phosphorylation | KRAKDTSSEEVNLSH CCCCCCCCCCCCHHH | 23403867 | ||
| 400 | Phosphorylation | SSEEVNLSHIVPCEP CCCCCCHHHEEECCC | 23403867 | ||
| 412 | Ubiquitination | CEPVPEEKPKELPEW CCCCCCCCCCCCCHH | - | ||
| 414 | Ubiquitination | PVPEEKPKELPEWSE CCCCCCCCCCCHHHH | - | ||
| 422 | Ubiquitination | ELPEWSEKVAHNILS CCCHHHHHHHHHHHC | - | ||
| 440 | Ubiquitination | WVSWGLVKGAEITGK CCCHHCCCCCCHHHH | 21906983 | ||
| 447 | Acetylation | KGAEITGKAIQKGAS CCCCHHHHHHHHHHH | 25953088 | ||
| 447 | Ubiquitination | KGAEITGKAIQKGAS CCCCHHHHHHHHHHH | 21906983 | ||
| 451 | Ubiquitination | ITGKAIQKGASKLRE HHHHHHHHHHHHHHH | - | ||
| 455 | Ubiquitination | AIQKGASKLRERIQP HHHHHHHHHHHHCCC | - | ||
| 465 | Acetylation | ERIQPEEKPVEVSPA HHCCCCCCCCCCCHH | 26051181 | ||
| 465 | Ubiquitination | ERIQPEEKPVEVSPA HHCCCCCCCCCCCHH | 21906983 | ||
| 470 | Phosphorylation | EEKPVEVSPAVTKGL CCCCCCCCHHHHCCE | 29255136 | ||
| 474 | Phosphorylation | VEVSPAVTKGLYIAK CCCCHHHHCCEEEEH | 29255136 | ||
| 474 | O-linked_Glycosylation | VEVSPAVTKGLYIAK CCCCHHHHCCEEEEH | 30059200 | ||
| 475 | Ubiquitination | EVSPAVTKGLYIAKQ CCCHHHHCCEEEEHH | 21906983 | ||
| 481 | Ubiquitination | TKGLYIAKQATGGAA HCCEEEEHHHCCCCC | - | ||
| 489 | Acetylation | QATGGAAKVSQFLVD HHCCCCCHHHHHHHC | 7712387 | ||
| 489 | Ubiquitination | QATGGAAKVSQFLVD HHCCCCCHHHHHHHC | - | ||
| 499 | S-nitrosocysteine | QFLVDGVCTVANCVG HHHHCCCCHHHHHCC | - | ||
| 504 | S-nitrosocysteine | GVCTVANCVGKELAP CCCHHHHHCCHHHHH | - | ||
| 507 | Ubiquitination | TVANCVGKELAPHVK HHHHHCCHHHHHHHH | 21906983 | ||
| 514 | Ubiquitination | KELAPHVKKHGSKLV HHHHHHHHHHCCCCC | - | ||
| 515 | Ubiquitination | ELAPHVKKHGSKLVP HHHHHHHHHCCCCCC | - | ||
| 518 | Phosphorylation | PHVKKHGSKLVPESL HHHHHHCCCCCCHHH | 28857561 | ||
| 519 | Ubiquitination | HVKKHGSKLVPESLK HHHHHCCCCCCHHHC | - | ||
| 524 | Phosphorylation | GSKLVPESLKKDKDG CCCCCCHHHCCCCCC | 25159151 | ||
| 526 | Ubiquitination | KLVPESLKKDKDGKS CCCCHHHCCCCCCCC | - | ||
| 527 | Ubiquitination | LVPESLKKDKDGKSP CCCHHHCCCCCCCCC | - | ||
| 529 | Ubiquitination | PESLKKDKDGKSPLD CHHHCCCCCCCCCCC | - | ||
| 532 | Ubiquitination | LKKDKDGKSPLDGAM HCCCCCCCCCCCCCE | - | ||
| 578 | Ubiquitination | TVQTVRYKYGYNAGE HEEEEHHHHCCCCCH | 21906983 | ||
| 578 | Sumoylation | TVQTVRYKYGYNAGE HEEEEHHHHCCCCCH | - | ||
| 578 (in isoform 1) | Ubiquitination | - | 22053931 | ||
| 602 | Phosphorylation | VNVGVTAYNINNIGI CCCCCEEEEECCCCH | 27642862 | ||
| 610 | Ubiquitination | NINNIGIKAMVKKTA EECCCCHHHHEEECC | - | ||
| 615 (in isoform 1) | Ubiquitination | - | 22053931 | ||
| 615 | Ubiquitination | GIKAMVKKTATQTGH CHHHHEEECCCCCCC | 21906983 | ||
| 616 | Phosphorylation | IKAMVKKTATQTGHT HHHHEEECCCCCCCC | 27642862 | ||
| 618 | Phosphorylation | AMVKKTATQTGHTLL HHEEECCCCCCCCHH | 27642862 | ||
| 620 | Phosphorylation | VKKTATQTGHTLLED EEECCCCCCCCHHEE | 28555341 | ||
| 628 | Phosphorylation | GHTLLEDYQIVDNSQ CCCHHEEEEECCCCH | 25884760 | ||
| 651 | Ubiquitination | NVNVRGEKDEQTKEV CCCCCCCCHHHHHHH | - | ||
| 655 | Phosphorylation | RGEKDEQTKEVKEAK CCCCHHHHHHHHHHH | 23025827 | ||
| 656 | Ubiquitination | GEKDEQTKEVKEAKK CCCHHHHHHHHHHHH | - |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPART_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPART_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
