UniProt ID | SOCS2_MOUSE | |
---|---|---|
UniProt AC | O35717 | |
Protein Name | Suppressor of cytokine signaling 2 | |
Gene Name | Socs2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 198 | |
Subcellular Localization | ||
Protein Description | SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).. | |
Protein Sequence | MTLRCLEPSGNGADRTRSQWGTAGLPEEQSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLAINKCTGTIWGLPLPTRLKDYLEEYKFQV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | SGNGADRTRSQWGTA CCCCCCCCHHHCCCC | 34.91 | 30635358 | |
18 | Phosphorylation | NGADRTRSQWGTAGL CCCCCCHHHCCCCCC | 29.67 | 30635358 | |
22 | Phosphorylation | RTRSQWGTAGLPEEQ CCHHHCCCCCCCHHH | 18.00 | 30635358 | |
30 | Phosphorylation | AGLPEEQSPEAARLA CCCCHHHCHHHHHHH | 28.17 | - | |
52 | Phosphorylation | QTGWYWGSMTVNEAK HHCCCCCCCCHHHHH | 9.35 | 31578312 | |
75 | Phosphorylation | GTFLIRDSSHSDYLL CCEEEECCCCCCEEE | 21.80 | 26643407 | |
76 | Phosphorylation | TFLIRDSSHSDYLLT CEEEECCCCCCEEEE | 31.16 | 26643407 | |
78 | Phosphorylation | LIRDSSHSDYLLTIS EEECCCCCCEEEEEE | 29.87 | 26643407 | |
80 | Phosphorylation | RDSSHSDYLLTISVK ECCCCCCEEEEEEEE | 13.46 | 26643407 | |
83 | Phosphorylation | SHSDYLLTISVKTSA CCCCEEEEEEEECCC | 14.49 | 26643407 | |
85 | Phosphorylation | SDYLLTISVKTSAGP CCEEEEEEEECCCCC | 16.60 | 26643407 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
52 | S | Phosphorylation | Kinase | PKC | - | Uniprot |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SOCS2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ELOC_HUMAN | TCEB1 | physical | 19385048 | |
ELOB_HUMAN | TCEB2 | physical | 19385048 | |
SOMA_MOUSE | Gh | physical | 12208853 | |
CISH_MOUSE | Cish | physical | 16684815 | |
CUL5_MOUSE | Cul5 | physical | 16684815 | |
ELOC_MOUSE | Tceb1 | physical | 16684815 | |
ELOB_MOUSE | Tceb2 | physical | 16684815 | |
FLT3_MOUSE | Flt3 | physical | 23548639 | |
NTRK1_RAT | Ntrk1 | physical | 24484474 | |
NTRK2_RAT | Ntrk2 | physical | 24484474 | |
NTRK3_RAT | Ntrk3 | physical | 24484474 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...