SOCS2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SOCS2_MOUSE
• UniProt AC: O35717
• Protein Name: Suppressor of cytokine signaling 2
• Gene Name: Socs2
• Organism: Mus musculus (Mouse).
• Sequence Length: 198
• Protein Description: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity)..
• Protein Sequence: MTLRCLEPSGNGADRTRSQWGTAGLPEEQSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLAINKCTGTIWGLPLPTRLKDYLEEYKFQV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	SGNGADRTRSQWGTA CCCCCCCCHHHCCCC	34.91	30635358
18	Phosphorylation	NGADRTRSQWGTAGL CCCCCCHHHCCCCCC	29.67	30635358
22	Phosphorylation	RTRSQWGTAGLPEEQ CCHHHCCCCCCCHHH	18.00	30635358
30	Phosphorylation	AGLPEEQSPEAARLA CCCCHHHCHHHHHHH	28.17	-
52	Phosphorylation	QTGWYWGSMTVNEAK HHCCCCCCCCHHHHH	9.35	31578312
75	Phosphorylation	GTFLIRDSSHSDYLL CCEEEECCCCCCEEE	21.80	26643407
76	Phosphorylation	TFLIRDSSHSDYLLT CEEEECCCCCCEEEE	31.16	26643407
78	Phosphorylation	LIRDSSHSDYLLTIS EEECCCCCCEEEEEE	29.87	26643407
80	Phosphorylation	RDSSHSDYLLTISVK ECCCCCCEEEEEEEE	13.46	26643407
83	Phosphorylation	SHSDYLLTISVKTSA CCCCEEEEEEEECCC	14.49	26643407
85	Phosphorylation	SDYLLTISVKTSAGP CCEEEEEEEECCCCC	16.60	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
52	S	Phosphorylation	Kinase	PKC	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
52	S	Phosphorylation	Phosphorylation at Ser-52 by PKC facilitates its ubiquitination and proteosomal degradation.	31578312
52	S	Phosphorylation	Ubiquitination is dependent on phosphorylation at Ser-52, by PKC and is stimulated by LPS.	31578312
52	S	ubiquitylation	Phosphorylation at Ser-52 by PKC facilitates its ubiquitination and proteosomal degradation.	31578312
52	S	ubiquitylation	Ubiquitination is dependent on phosphorylation at Ser-52, by PKC and is stimulated by LPS.	31578312

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SOCS2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELOC_HUMAN	TCEB1	physical	19385048
ELOB_HUMAN	TCEB2	physical	19385048
SOMA_MOUSE	Gh	physical	12208853
CISH_MOUSE	Cish	physical	16684815
CUL5_MOUSE	Cul5	physical	16684815
ELOC_MOUSE	Tceb1	physical	16684815
ELOB_MOUSE	Tceb2	physical	16684815
FLT3_MOUSE	Flt3	physical	23548639
NTRK1_RAT	Ntrk1	physical	24484474
NTRK2_RAT	Ntrk2	physical	24484474
NTRK3_RAT	Ntrk3	physical	24484474

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.