CISH_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CISH_MOUSE
• UniProt AC: Q62225
• Protein Name: Cytokine-inducible SH2-containing protein
• Gene Name: Cish
• Organism: Mus musculus (Mouse).
• Sequence Length: 257
• Protein Description: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolactin and interleukin 3 (IL3) receptor. Inhibits STAT5 trans-activation by suppressing its tyrosine phosphorylation. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity)..
• Protein Sequence: MVLCVQGSCPLLAVEQIGRRPLWAQSLELPGPAMQPLPTGAFPEEVTEETPVQAENEPKVLDPEGDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAPTPALPMSKQDAPSDSVLPIPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
75	Phosphorylation	LCIAKTFSYLRESGW EEEEEHHHHHHHHCC	28.61	22817900
173	Phosphorylation	SCAADTRSDSPDPAP HHHHCCCCCCCCCCC	44.53	27566939
175	Phosphorylation	AADTRSDSPDPAPTP HHCCCCCCCCCCCCC	32.23	30482847
253	Phosphorylation	MADYLRQYPFQL--- HHHHHHHCCCCC---	10.28	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CISH_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CISH_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CISH_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELOC_HUMAN	TCEB1	physical	19385048
ELOB_HUMAN	TCEB2	physical	19385048
ABL1_MOUSE	Abl1	physical	11274764
KPCA_MOUSE	Prkca	physical	12618484
KPCB_MOUSE	Prkcb	physical	12618484
KPCT_MOUSE	Prkcq	physical	12618484

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.