| UniProt ID | SLX8_SCHPO | |
|---|---|---|
| UniProt AC | P87176 | |
| Protein Name | E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8 | |
| Gene Name | slx8 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 269 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Mediates ubiquitination and subsequent desumoylation/degradation of sumoylated proteins and proteins containing SUMO-like domains. Acts as a critical suppressor of gross chromosomal rearrangements (GCRs) during normal cell cycle progression. Involved in stabilizing, restarting or resolving transiently stalled replication forks. Prevents accumulation of DNA damage during cell cycle progression (By similarity).. | |
| Protein Sequence | MPPAHKRDTNVRNLSAPYNIPSQSARVAAGNAAINRRRSSPVENSPGNGFPVSEDATDYPSGTTSENESLPLNRAPRSLREVASELAQEETLPVETSDLNIDVESEVFDLEDINFQNDADDINQRFTYNNHPASVENSLTNVNSIHAQPTTISDMIDLTDETSYDPRKQKFEQGKNPSTTNAEIEKEEPSKKQVVPSSQRLADYKCVICLDSPENLSCTPCGHIFCNFCILSALGTTAATQKCPVCRRKVHPNKVICLEMMLGSQKKKS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SLX8_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SLX8_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SLX8_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SLX8_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RAD60_SCHPO | rad60 | genetic | 17762865 | |
| HUS2_SCHPO | rqh1 | genetic | 17762865 | |
| EME1_SCHPO | eme1 | genetic | 17762865 | |
| RAD55_SCHPO | rad55 | genetic | 17762865 | |
| RNF4_HUMAN | RNF4 | genetic | 17762865 | |
| RAD60_SCHPO | rad60 | physical | 17762865 | |
| PLI1_SCHPO | pli1 | genetic | 17762865 | |
| TYDP1_SCHPO | tdp1 | genetic | 21408210 | |
| RIA1_SCHPO | ria1 | genetic | 22681890 | |
| PLI1_SCHPO | pli1 | genetic | 23936535 | |
| NSE2_SCHPO | nse2 | genetic | 23936535 | |
| RAD18_SCHPO | rhp18 | genetic | 24265825 | |
| NU132_SCHPO | nup132 | genetic | 26221037 | |
| PMT3_SCHPO | pmt3 | genetic | 21444718 | |
| PLI1_SCHPO | pli1 | genetic | 21444718 | |
| PMT3_SCHPO | pmt3 | genetic | 26537787 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
